Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP45222_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45222_P050-FITC Conjugated

ARP45222_P050-HRP Conjugated

ARP45222_P050-Biotin Conjugated

HMOX1 Antibody - N-terminal region (ARP45222_P050)

Catalog#: ARP45222_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-10789 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human HMOX1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-HMOX1 (ARP45222_P050)
Peptide Sequence Synthetic peptide located within the following region: ERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVM
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HMOX1 (ARP45222_P050) antibody is Catalog # AAP45222
Datasheets/Manuals Printable datasheet for anti-HMOX1 (ARP45222_P050) antibody
Publications

Kawahara, G. et al. Dystrophic muscle improvement in zebrafish via increased heme oxygenase signaling. Hum. Mol. Genet. 23, 1869-78 (2014). WB, Cow, Dog, Goat, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat 24234649

Gene Symbol HMOX1
Official Gene Full Name Heme oxygenase (decycling) 1
Alias Symbols HO-1, HSP32, bK286B10
NCBI Gene Id 3162
Protein Name Heme oxygenase 1
Description of Target HMOX1 belongs to the heme oxygenase family. Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2.
Swissprot Id P09601
Protein Accession # NP_002124
Nucleotide Accession # NM_002133
Protein Size (# AA) 288
Molecular Weight 33kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HMOX1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HMOX1.
Protein Interactions CCDC155; UBC; TUT1; CPSF1; ASL; POT1; TERF1; ELAVL1; HMX1; BLVRB; AKT1; NOS1; HMOX1; POR; UFD1L; PSMD2;
  1. What is the species homology for "HMOX1 Antibody - N-terminal region (ARP45222_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "HMOX1 Antibody - N-terminal region (ARP45222_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HMOX1 Antibody - N-terminal region (ARP45222_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HMOX1 Antibody - N-terminal region (ARP45222_P050)"?

    This target may also be called "HO-1, HSP32, bK286B10" in publications.

  5. What is the shipping cost for "HMOX1 Antibody - N-terminal region (ARP45222_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HMOX1 Antibody - N-terminal region (ARP45222_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HMOX1 Antibody - N-terminal region (ARP45222_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HMOX1 Antibody - N-terminal region (ARP45222_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HMOX1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HMOX1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HMOX1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HMOX1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HMOX1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HMOX1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HMOX1 Antibody - N-terminal region (ARP45222_P050)
Your Rating
We found other products you might like!