Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

HMOX1 Antibody - N-terminal region (ARP45222_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45222_P050-FITC Conjugated

ARP45222_P050-HRP Conjugated

ARP45222_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Heme oxygenase (decycling) 1
NCBI Gene Id:
Protein Name:
Heme oxygenase 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
HO-1, HSP32, bK286B10
Replacement Item:
This antibody may replace item sc-10789 from Santa Cruz Biotechnology.
Description of Target:
HMOX1 belongs to the heme oxygenase family. Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HMOX1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HMOX1.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HMOX1
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-HMOX1 (ARP45222_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HMOX1 (ARP45222_P050) antibody is Catalog # AAP45222
Printable datasheet for anti-HMOX1 (ARP45222_P050) antibody

Kawahara, G. et al. Dystrophic muscle improvement in zebrafish via increased heme oxygenase signaling. Hum. Mol. Genet. 23, 1869-78 (2014). WB, Cow, Dog, Goat, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat 24234649

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...