| Product Number |
ARP44426_P050 |
| Product Page |
www.avivasysbio.com/lycat-antibody-middle-region-arp44426-p050.html |
| Name |
LYCAT Antibody - middle region (ARP44426_P050) |
| Protein Size (# AA) |
376 amino acids |
| Molecular Weight |
44kDa |
| NCBI Gene Id |
253558 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Lysocardiolipin acyltransferase 1 |
| Alias Symbols |
LYCAT, AGPAT8, ALCAT1, 1AGPAT8, UNQ1849, HSRG1849 |
| Peptide Sequence |
Synthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Wang,C., (2007) Blood 110 (10), 3601-3609 |
| Description of Target |
LYCAT is an acyl-CoA:lysocardiolipin acyltransferase. It possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. LYCAT recognizes both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. LYCAT acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. It converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. LYCAT is required for establishment of the hematopoietic and endothelial lineages. |
| Protein Interactions |
LNX1; GOPC; RNF2; UBC; ELAVL1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LCLAT1 (ARP44426_P050) antibody |
| Blocking Peptide |
For anti-LCLAT1 (ARP44426_P050) antibody is Catalog # AAP44426 (Previous Catalog # AAPP25736) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LYCAT |
| Uniprot ID |
Q6UWP7 |
| Protein Name |
cDNA FLJ61482, highly similar to Homo sapiens lysocardiolipin acyltransferase (LYCAT), transcript variant 1, mRNA EMBL BAG63827.1 |
| Publications |
LPS impairs oxygen utilization in epithelia by triggering degradation of the mitochondrial enzyme Alcat1. J. Cell. Sci. 129, 51-64 (2016). 26604221 |
| Protein Accession # |
NP_001002257 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001002257 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LCLAT1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 92%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92% |
| Image 1 | Human Fetal Liver
 | Host: Rabbit
Target Name: LYCAT
Sample Tissue: Human Fetal Liver
Antibody Dilution: 1.0ug/ml |
|
