Size:100 ul
$319.00
In Stock
SKU
ARP44426_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP44426_P050-FITC Conjugated

ARP44426_P050-HRP Conjugated

ARP44426_P050-Biotin Conjugated

LYCAT Antibody - middle region (ARP44426_P050)

Catalog#: ARP44426_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human LYCAT
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 92%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%
Complete computational species homology dataAnti-LYCAT (ARP44426_P050)
Peptide SequenceSynthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-LCLAT1 (ARP44426_P050) antibody is Catalog # AAP44426 (Previous Catalog # AAPP25736)
Datasheets/ManualsPrintable datasheet for anti-LCLAT1 (ARP44426_P050) antibody
Target ReferenceWang,C., (2007) Blood 110 (10), 3601-3609
Publications

Zou, C; Synan, MJ; Li, J; Xiong, S; Manni, ML; Liu, Y; Chen, BB; Zhao, Y; Shiva, S; Tyurina, YY; Jiang, J; Lee, JS; Das, S; Ray, A; Ray, P; Kagan, VE; Mallampalli, RK; LPS impairs oxygen utilization in epithelia by triggering degradation of the mitochondrial enzyme Alcat1. 129, 51-64 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26604221

Gene SymbolLCLAT1
Official Gene Full NameLysocardiolipin acyltransferase 1
Alias SymbolsALCAT1, FLJ37965, UNQ1849, LYCAT, AGPAT8, 1AGPAT8, HSRG1849
NCBI Gene Id253558
Protein NamecDNA FLJ61482, highly similar to Homo sapiens lysocardiolipin acyltransferase (LYCAT), transcript variant 1, mRNA EMBL BAG63827.1
Description of TargetLYCAT is an acyl-CoA:lysocardiolipin acyltransferase. It possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. LYCAT recognizes both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. LYCAT acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. It converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. LYCAT is required for establishment of the hematopoietic and endothelial lineages.
Swissprot IdQ6UWP7
Protein Accession #NP_001002257
Nucleotide Accession #NM_001002257
Protein Size (# AA)376
Molecular Weight44kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express LYCAT.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express LYCAT.
Protein InteractionsLNX1; GOPC; RNF2; UBC; ELAVL1;
Write Your Own Review
You're reviewing:LYCAT Antibody - middle region (ARP44426_P050)
Your Rating
Aviva HIS tag Deal
Aviva Blast Tool
Aviva Travel Grant
Free Microscope