Search Antibody, Protein, and ELISA Kit Solutions

LYCAT antibody - middle region (ARP44426_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44426_P050-FITC Conjugated

ARP44426_P050-HRP Conjugated

ARP44426_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
LCLAT1
NCBI Gene Id:
253558
Official Gene Full Name:
Lysocardiolipin acyltransferase 1
Protein Name:
cDNA FLJ61482, highly similar to Homo sapiens lysocardiolipin acyltransferase (LYCAT), transcript variant 1, mRNA EMBL BAG63827.1
Swissprot Id:
Q6UWP7
Protein Accession #:
NP_001002257
Nucleotide Accession #:
NM_001002257
Alias Symbols:
ALCAT1, FLJ37965, UNQ1849, LYCAT, AGPAT8, 1AGPAT8, HSRG1849
Description of Target:
LYCAT is an acyl-CoA:lysocardiolipin acyltransferase. It possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. LYCAT recognizes both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. LYCAT acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. It converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. LYCAT is required for establishment of the hematopoietic and endothelial lineages.
Protein Size (# AA):
376
Molecular Weight:
44kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LYCAT.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LYCAT.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human LYCAT
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 92%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%
Complete computational species homology data:
Anti-LYCAT (ARP44426_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
LNX1; GOPC; RNF2; UBC; ELAVL1;
Blocking Peptide:
For anti-LCLAT1 (ARP44426_P050) antibody is Catalog # AAP44426 (Previous Catalog # AAPP25736)
Datasheets/Manuals:
Printable datasheet for anti-LCLAT1 (ARP44426_P050) antibody
Target Reference:
Wang,C., (2007) Blood 110 (10), 3601-3609
Publications:

Zou, C; Synan, MJ; Li, J; Xiong, S; Manni, ML; Liu, Y; Chen, BB; Zhao, Y; Shiva, S; Tyurina, YY; Jiang, J; Lee, JS; Das, S; Ray, A; Ray, P; Kagan, VE; Mallampalli, RK; LPS impairs oxygen utilization in epithelia by triggering degradation of the mitochondrial enzyme Alcat1. 129, 51-64 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26604221

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...