Size:100 ul
$319.00
In Stock
SKU
ARP44426_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP44426_P050-FITC Conjugated

ARP44426_P050-HRP Conjugated

ARP44426_P050-Biotin Conjugated

LYCAT Antibody - middle region (ARP44426_P050)

Catalog#: ARP44426_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human LYCAT
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 92%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%
Complete computational species homology data Anti-LYCAT (ARP44426_P050)
Peptide Sequence Synthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-LCLAT1 (ARP44426_P050) antibody is Catalog # AAP44426 (Previous Catalog # AAPP25736)
Datasheets/Manuals Printable datasheet for anti-LCLAT1 (ARP44426_P050) antibody
Target Reference Wang,C., (2007) Blood 110 (10), 3601-3609
Publications

Zou, C; Synan, MJ; Li, J; Xiong, S; Manni, ML; Liu, Y; Chen, BB; Zhao, Y; Shiva, S; Tyurina, YY; Jiang, J; Lee, JS; Das, S; Ray, A; Ray, P; Kagan, VE; Mallampalli, RK; LPS impairs oxygen utilization in epithelia by triggering degradation of the mitochondrial enzyme Alcat1. 129, 51-64 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26604221

Gene Symbol LCLAT1
Official Gene Full Name Lysocardiolipin acyltransferase 1
Alias Symbols ALCAT1, FLJ37965, UNQ1849, LYCAT, AGPAT8, 1AGPAT8, HSRG1849
NCBI Gene Id 253558
Protein Name cDNA FLJ61482, highly similar to Homo sapiens lysocardiolipin acyltransferase (LYCAT), transcript variant 1, mRNA EMBL BAG63827.1
Description of Target LYCAT is an acyl-CoA:lysocardiolipin acyltransferase. It possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. LYCAT recognizes both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. LYCAT acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. It converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. LYCAT is required for establishment of the hematopoietic and endothelial lineages.
Swissprot Id Q6UWP7
Protein Accession # NP_001002257
Nucleotide Accession # NM_001002257
Protein Size (# AA) 376
Molecular Weight 44kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LYCAT.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LYCAT.
Protein Interactions LNX1; GOPC; RNF2; UBC; ELAVL1;
  1. What is the species homology for "LYCAT Antibody - middle region (ARP44426_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "LYCAT Antibody - middle region (ARP44426_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LYCAT Antibody - middle region (ARP44426_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LYCAT Antibody - middle region (ARP44426_P050)"?

    This target may also be called "ALCAT1, FLJ37965, UNQ1849, LYCAT, AGPAT8, 1AGPAT8, HSRG1849" in publications.

  5. What is the shipping cost for "LYCAT Antibody - middle region (ARP44426_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LYCAT Antibody - middle region (ARP44426_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LYCAT Antibody - middle region (ARP44426_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LYCAT Antibody - middle region (ARP44426_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "LCLAT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LCLAT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LCLAT1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LCLAT1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LCLAT1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LCLAT1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LYCAT Antibody - middle region (ARP44426_P050)
Your Rating
We found other products you might like!