SRD5A2 Antibody - N-terminal region (ARP44264_P050)

Data Sheet
 
Product Number ARP44264_P050
Product Page www.avivasysbio.com/srd5a2-antibody-n-terminal-region-arp44264-p050.html
Name SRD5A2 Antibody - N-terminal region (ARP44264_P050)
Protein Size (# AA) 254 amino acids
Molecular Weight 28kDa
NCBI Gene Id 6716
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Alias Symbols MGC138457
Peptide Sequence Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SRD5A2 (ARP44264_P050) antibody
Blocking Peptide For anti-SRD5A2 (ARP44264_P050) antibody is Catalog # AAP44264 (Previous Catalog # AAPP25644)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SRD5A2
Uniprot ID Q28892
Protein Name 3-oxo-5-alpha-steroid 4-dehydrogenase 2
Protein Accession # NP_000339
Purification Affinity Purified
Nucleotide Accession # NM_000348
Tested Species Reactivity Human, Monkey
Gene Symbol SRD5A2
Predicted Species Reactivity Human, Pig, Rabbit, Monkey
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Pig: 86%; Rabbit: 91%
Image 1
Monkey adrenal gland
Sample Type:
Monkey adrenal gland
Primary Antibody Dilution:
1:25
Secondary Antibody:
Anti-rabbit-HRP
Secondary Antibody Dilution:
1:1000
Color/Signal Descriptions:
Brown: SRD5A2 Blue: Nucleus
Gene Name:
SRD5A2
Submitted by:
Jonathan Bertin, Endoceutics Inc.
Image 2
Monkey vagina
Sample Type:
Monkey vagina
Primary Antibody Dilution:
1:25
Secondary Antibody:
Anti-rabbit-HRP
Secondary Antibody Dilution:
1:1000
Color/Signal Descriptions:
Brown: SRD5A2 Blue: Nucleus
Gene Name:
SRD5A2
Submitted by:
Jonathan Bertin, Endoceutics Inc.
Image 3
Human THP-1
WB Suggested Anti-SRD5A2 Antibody Titration: 0.2-1 ug/ml
Positive Control: THP-1 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com