Size:100 ul
$319.00
In Stock
SKU
ARP44264_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP44264_P050-FITC Conjugated

ARP44264_P050-HRP Conjugated

ARP44264_P050-Biotin Conjugated

SRD5A2 Antibody - N-terminal region (ARP44264_P050)

Rating:
80% of 100
Catalog#: ARP44264_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman, Monkey
Predicted Species ReactivityHuman, Pig, Rabbit, Monkey
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-20400 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SRD5A2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Pig: 86%; Rabbit: 91%
Complete computational species homology dataAnti-SRD5A2 (ARP44264_P050)
Peptide SequenceSynthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-SRD5A2 (ARP44264_P050) antibody is Catalog # AAP44264 (Previous Catalog # AAPP25644)
Datasheets/ManualsPrintable datasheet for anti-SRD5A2 (ARP44264_P050) antibody
Gene SymbolSRD5A2
Official Gene Full NameSteroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Alias SymbolsMGC138457
NCBI Gene Id6716
Protein Name3-oxo-5-alpha-steroid 4-dehydrogenase 2
Description of TargetThis gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result
Swissprot IdQ28892
Protein Accession #NP_000339
Nucleotide Accession #NM_000348
Protein Size (# AA)254
Molecular Weight28kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express SRD5A2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express SRD5A2.
  1. What is the species homology for "SRD5A2 Antibody - N-terminal region (ARP44264_P050)"?

    The tested species reactivity for this item is "Human, Monkey". This antibody is predicted to have homology to "Human, Pig, Rabbit, Monkey".

  2. How long will it take to receive "SRD5A2 Antibody - N-terminal region (ARP44264_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SRD5A2 Antibody - N-terminal region (ARP44264_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SRD5A2 Antibody - N-terminal region (ARP44264_P050)"?

    This target may also be called "MGC138457" in publications.

  5. What is the shipping cost for "SRD5A2 Antibody - N-terminal region (ARP44264_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SRD5A2 Antibody - N-terminal region (ARP44264_P050)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "SRD5A2 Antibody - N-terminal region (ARP44264_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "28kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SRD5A2 Antibody - N-terminal region (ARP44264_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SRD5A2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SRD5A2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SRD5A2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SRD5A2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SRD5A2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SRD5A2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SRD5A2 Antibody - N-terminal region (ARP44264_P050)
Your Rating
Assay Development
Aviva Pathways
Aviva Travel Grant
Aviva HIS tag Deal