MARCH11 Antibody - C-terminal region : FITC (ARP43511_P050-FITC)

• Product Number: ARP43511_P050-FITC
• Name: MARCH11 Antibody - C-terminal region : FITC (ARP43511_P050-FITC)
• Protein Size (# AA): 402 amino acids
• Molecular Weight: 44kDa
• Conjugation: FITC: Fluorescein Isothiocyanate
• NCBI Gene Id: 441061
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: membrane associated ring-CH-type finger 11
• Alias Symbols: RNF226, MARCH11, MARCH-XI
• Peptide Sequence: Synthetic peptide located within the following region: RVFKRWRAVNLHWDVLNYDKATDIEESSRGESSTSRTLWLPLTALRNRNL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Description of Target: MARCH11 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). These enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their intracellular transport. March11 appears to have a role in ubiquitin-mediated protein sorting in the trans-Golgi network (TGN)-multivesicular body (MVB) transport pathway (Morokuma et al., 2007 [PubMed 17604280]).[supplied by OMIM, Apr 2010]
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-MARCH11 (ARP43511_P050-FITC) antibody is Catalog # AAP43511
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MARHB
• Uniprot ID: A6NNE9
• Protein Name: E3 ubiquitin-protein ligase MARCH11
• Protein Accession #: NP_001096032
• Purification: Affinity Purified
• Gene Symbol: MARCH11
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: