Search Antibody, Protein, and ELISA Kit Solutions

MARCH11 Antibody - C-terminal region : FITC (ARP43511_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43511_P050 Unconjugated

ARP43511_P050-HRP Conjugated

ARP43511_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
MARCH11
Official Gene Full Name:
membrane associated ring-CH-type finger 11
NCBI Gene Id:
441061
Protein Name:
E3 ubiquitin-protein ligase MARCH11
Swissprot Id:
A6NNE9
Protein Accession #:
NP_001096032
Alias Symbols:
RNF226, MARCH-XI
Description of Target:
MARCH11 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). These enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their intracellular transport. March11 appears to have a role in ubiquitin-mediated protein sorting in the trans-Golgi network (TGN)-multivesicular body (MVB) transport pathway (Morokuma et al., 2007 [PubMed 17604280]).[supplied by OMIM, Apr 2010]
Protein Size (# AA):
402
Molecular Weight:
44kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MARCH11.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MARCH11.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MARHB
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: RVFKRWRAVNLHWDVLNYDKATDIEESSRGESSTSRTLWLPLTALRNRNL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-MARCH11 (ARP43511_P050-FITC) antibody is Catalog # AAP43511
Datasheets/Manuals:
Printable datasheet for anti-MARCH11 (ARP43511_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...