| Product Number |
ARP43221_P050 |
| Product Page |
www.avivasysbio.com/bfar-antibody-middle-region-arp43221-p050.html |
| Name |
Bfar Antibody - middle region (ARP43221_P050) |
| Protein Size (# AA) |
450 amino acids |
| Molecular Weight |
53kDa |
| NCBI Gene Id |
67118 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Bifunctional apoptosis regulator |
| Alias Symbols |
Bar, RNF, Rnf47, AI666707, AW107665, 3110001I22, 3010001A07Rik, 3110001I22Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: NDVVQSLAAFQKYGNDQNPLAPSTGRVNPQRGGGFFSGVLTALTGVAVIL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Bfar is an apoptosis regulator. It has anti-apoptotic activity, both for apoptosis triggered via death-receptors and via mitochondrial factors. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Bfar (ARP43221_P050) antibody |
| Blocking Peptide |
For anti-Bfar (ARP43221_P050) antibody is Catalog # AAP43221 (Previous Catalog # AAPP25189) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q8R079 |
| Protein Name |
Bifunctional apoptosis regulator |
| Protein Accession # |
NP_080252 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_025976 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Bfar |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100% |
| Image 1 | Mouse Brain
 | WB Suggested Anti-Bfar Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Brain |
|
|
