Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP43221_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43221_P050-FITC Conjugated

ARP43221_P050-HRP Conjugated

ARP43221_P050-Biotin Conjugated

Bfar Antibody - middle region (ARP43221_P050)

Rating:
100% of 100
Catalog#: ARP43221_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityMouse
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-11124 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Complete computational species homology dataAnti-Bfar (ARP43221_P050)
Peptide SequenceSynthetic peptide located within the following region: NDVVQSLAAFQKYGNDQNPLAPSTGRVNPQRGGGFFSGVLTALTGVAVIL
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-Bfar (ARP43221_P050) antibody is Catalog # AAP43221 (Previous Catalog # AAPP25189)
Datasheets/ManualsPrintable datasheet for anti-Bfar (ARP43221_P050) antibody
Gene SymbolBfar
Official Gene Full NameBifunctional apoptosis regulator
Alias Symbols3010001A07Rik, AI666707, AW107665, BAR, RNF47, Bar, Rnf47
NCBI Gene Id67118
Protein NameBifunctional apoptosis regulator
Description of TargetBfar is an apoptosis regulator. It has anti-apoptotic activity, both for apoptosis triggered via death-receptors and via mitochondrial factors.
Swissprot IdQ8R079
Protein Accession #NP_080252
Nucleotide Accession #NM_025976
Protein Size (# AA)450
Molecular Weight53kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express Bfar.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express Bfar.
Write Your Own Review
You're reviewing:Bfar Antibody - middle region (ARP43221_P050)
Your Rating
Aviva Tips and Tricks
Free Microscope
Aviva Live Chat
Aviva Pathways