Search Antibody, Protein, and ELISA Kit Solutions

Bfar Antibody - middle region (ARP43221_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43221_P050-FITC Conjugated

ARP43221_P050-HRP Conjugated

ARP43221_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Bifunctional apoptosis regulator
NCBI Gene Id:
Protein Name:
Bifunctional apoptosis regulator
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
3010001A07Rik, AI666707, AW107665, BAR, RNF47, Bar, Rnf47
Replacement Item:
This antibody may replace item sc-11124 from Santa Cruz Biotechnology.
Description of Target:
Bfar is an apoptosis regulator. It has anti-apoptotic activity, both for apoptosis triggered via death-receptors and via mitochondrial factors.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Bfar.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Bfar.
The immunogen is a synthetic peptide corresponding to a region of Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Complete computational species homology data:
Anti-Bfar (ARP43221_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NDVVQSLAAFQKYGNDQNPLAPSTGRVNPQRGGGFFSGVLTALTGVAVIL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Bfar (ARP43221_P050) antibody is Catalog # AAP43221 (Previous Catalog # AAPP25189)
Printable datasheet for anti-Bfar (ARP43221_P050) antibody

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

128/05/2018 19:27
  • Quality:
  • Overall Experience:
HEK-293 Cell lysates in WB

Submitted by: Anonymous


1.             Sample Type/Lane Description:

Human HEK293 Cell Lysates

Lane 1: 40 ug untreated HEK293 cells (control)

Lane 2: 40 ug HEK293 cells + OA (Oligomycin + AntimycinA)

Lane 3: 40 ug HEK293 cells + CCCP

Lane 4: 40 ug HEK293 cells + Staurosporine

2.      Primary antibody dilution:


3.    Secondary antibody and dilution:

HRP-Goat anti-Rabbit IgG - 1:10,000

4.     Protocol:

HEK293 control cells, as well as cells treated with OA, CCCP, Staurosporine were lysed using a Triton X-100 based lysis buffer (1% Triton X-100, 10% glycerol, 150 mM NaCl, 20 mM Tris (pH 7.5), 2 mM EDTA) in the presence of a protease inhibitor mix. 40 μg of whole cell extract was mixed with 2 × SDS-sample buffer and boiled for 5 min. The samples were resolved on 12% SDS-PAGE and electro-transferred PVDF membranes using a semi-dry cell transfer blot. 4% nonfat dry milk in TBST buffer (25 mM Tris–HCl, pH 8.0, 125 mM NaCl, 0.1% Tween 20) was used to block nonspecific binding of the membrane. The membrane was incubated overnight at 4oC with TECPR1 (1:500 in TBST+ 4%Milk) primary antibodies followed by the specific secondary peroxidase-conjugated antibodies. The membrane was visualized by enhanced chemiluminescence (ECL) and developed using X-ray film.

Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...