WWP1 Antibody - N-terminal region (ARP43084_P050)

• Product Number: ARP43084_P050
• Name: WWP1 Antibody - N-terminal region (ARP43084_P050)
• Protein Size (# AA): 922 amino acids
• Molecular Weight: 105kDa
• NCBI Gene Id: 11059
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: WW domain containing E3 ubiquitin protein ligase 1
• Alias Symbols: AIP5, Tiul1, hSDRP1
• Peptide Sequence: Synthetic peptide located within the following region: ATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEIT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Heidecker,G., (2007) J. Virol. 81 (18), 9769-9777
• Description of Target: WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. WWP1 is a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. WWP1 belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes.WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. The encoded protein belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. Alternative splicing of this gene generates at least 6 transcript variants; however, the full length nature of these transcripts has not been defined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: SMAD3; FBXL18; WWP1; TRAF4; FAM189A2; UBE2L3; UBC; PTCH1; SMAD6; NOTCH1; EZH2; YWHAQ; CPSF6; TRAF6; LAPTM5; SMAD5; HSP90AA1; FBXL15; H2AFY2; PHF20L1; RNF11; ASH2L; PRKAA2; ATN1; LNX1; TP63; PTPN14; ERBB4; NFE2; SMAD7; SMAD4; SMAD2; SMAD1; RUNX2; Axin1; ga
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-WWP1 (ARP43084_P050) antibody is Catalog # AAP43084 (Previous Catalog # AAPP25059)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WWP1
• Uniprot ID: Q9H0M0
• Protein Name: NEDD4-like E3 ubiquitin-protein ligase WWP1
• Sample Type Confirmation:

  WWP1 is supported by BioGPS gene expression data to be expressed in HEK293T

• Protein Accession #: NP_008944
• Purification: Affinity Purified
• Nucleotide Accession #: NM_007013
• Tested Species Reactivity: Human
• Gene Symbol: WWP1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 100%
• Image 1: Human 293T
  
  WB Suggested Anti-WWP1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: 293T cell lysateWWP1 is supported by BioGPS gene expression data to be expressed in HEK293T
• Image 2: Human Pineal Tissue
  
  Rabbit Anti-WWP1 Antibody
  Catalog Number: ARP43084_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
  Observed Staining: Nuclear in pinealocytes
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
  
• Image 3: Human Jurkat Whole Cell
  
  Host: Rabbit
  Target Name: WWP1
  Sample Tissue: Human Jurkat Whole Cell
  Antibody Dilution: 1ug/ml