SLC38A3 Antibody - N-terminal region (ARP42323_P050)

• Product Number: ARP42323_P050
• Name: SLC38A3 Antibody - N-terminal region (ARP42323_P050)
• Protein Size (# AA): 504 amino acids
• Molecular Weight: 56 kDa
• NCBI Gene Id: 10991
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Solute carrier family 38, member 3
• Alias Symbols: G17, SN1, NAT1, SNAT3
• Peptide Sequence: Synthetic peptide located within the following region: GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Sidoryk,M., (2004) Neuroreport 15 (4), 575-578
• Description of Target: As a sodium-dependent amino acid/proton antiporter, SLC38A3 mediates electrogenic cotransport of glutamine and sodium ions in exchange for protons. It also recognizes histidine, asparagine and alanine. It may mediate amino acid transport in either direction under physiological conditions and£íay play a role in nitrogen metabolism and synaptic transmission.
• Protein Interactions: HMGN1; COL6A2; NEDD4; SETDB1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-SLC38A3 (ARP42323_P050) antibody is Catalog # AAP42323 (Previous Catalog # AAPS12405)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC38A3
• Uniprot ID: Q99624
• Protein Name: Sodium-coupled neutral amino acid transporter 3
• Sample Type Confirmation:

  SLC38A3 is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_006832
• Purification: Affinity Purified
• Nucleotide Accession #: NM_006841
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: SLC38A3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 86%
• Image 1: Mouse retina-outer plexiform layer
  
  Primary Antibody Dilution:
  1:200
  Secondary Antibody:
  Goat anti-rabbit Alexafluor 568
  Secondary Antibody Dilution:
  1:200
  Color/Signal Descriptions:
  SLC38A3: Red CtBp: Green DAPI: Blue
  Gene Name:
  SLC38A3
  Submitted by:
  Anonymous
• Image 2: Mouse retina
  
  Primary Antibody Dilution:
  1:200
  Secondary Antibody:
  Goat anti-rabbit Alexafluor 568
  Secondary Antibody Dilution:
  1:200
  Color/Signal Descriptions:
  SLC38A3: Red CtBp: Green DAPI: Blue
  Gene Name:
  SLC38A3
  Submitted by:
  Anonymous
• Image 3: Human Colon, Submucosal Plexus
  
  Rabbit Anti-SLC38A3 antibody
  Catalog Number: ARP42323
  Formalin Fixed Paraffin Embedded Tissue: Human Colon, Submucosal Plexus
  Primary antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20x
  Exposure Time: 0.5-2.0sec
• Image 4: Human Placenta
  
  Rabbit Anti-SLC38A3 antibody
  Catalog Number: ARP42323
  Formalin Fixed Paraffin Embedded Tissue: Human Placenta
  Primary antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20x
  Exposure Time: 0.5-2.0sec
• Image 5:
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.