LEFTY2 Antibody - N-terminal region (ARP42107_P050)

• Product Number: ARP42107_P050
• Name: LEFTY2 Antibody - N-terminal region (ARP42107_P050)
• Protein Size (# AA): 366 amino acids
• Molecular Weight: 40kDa
• NCBI Gene Id: 7044
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Left-right determination factor 2
• Alias Symbols: EBAF, LEFTA, TGFB4, LEFTYA
• Peptide Sequence: Synthetic peptide located within the following region: MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Cornet,P.B., (2005) J. Clin. Endocrinol. Metab. 90 (2), 1001-1011
• Description of Target: LEFTY2 is a member of the TGF-beta family of proteins. The protein is secreted and plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in its gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of its gene in the endometrium.This gene encodes a member of the TGF-beta family of proteins. The encoded protein is secreted and plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in this gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of this gene in the endometrium. Alternative processing of this protein can yield three different products. This gene is closely linked to both a related family member and a related pseudogene.
• Protein Interactions: ACSS3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-LEFTY2 (ARP42107_P050) antibody is Catalog # AAP42107 (Previous Catalog # AAPP24586)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LEFTY2
• Uniprot ID: O00292
• Protein Name: Left-right determination factor 2
• Sample Type Confirmation:

  LEFTY2 is supported by BioGPS gene expression data to be expressed in RPMI 8226

• Protein Accession #: NP_003231
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003240
• Tested Species Reactivity: Human
• Gene Symbol: LEFTY2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Horse, Pig
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 86%; Rat: 83%
• Image 1: Human Uterus
  
  Immunohistochemistry with Uterus tissue at an antibody concentration of 5ug/ml using anti-LEFTY2 antibody (ARP42107_P050)
• Image 2: Human RPMI 8226
  
  WB Suggested Anti-LEFTY2 Antibody Titration: 0.2-1 ug/ml
  Positive Control: RPMI 8226 cell lysateLEFTY2 is supported by BioGPS gene expression data to be expressed in RPMI 8226