Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP42107_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42107_P050-FITC Conjugated

ARP42107_P050-HRP Conjugated

ARP42107_P050-Biotin Conjugated

LEFTY2 Antibody - N-terminal region (ARP42107_P050)

Catalog#: ARP42107_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Horse, Human, Mouse, Pig, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-115341 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LEFTY2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 79%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 86%; Rat: 83%
Complete computational species homology data Anti-LEFTY2 (ARP42107_P050)
Peptide Sequence Synthetic peptide located within the following region: MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-LEFTY2 (ARP42107_P050) antibody is Catalog # AAP42107 (Previous Catalog # AAPP24586)
Datasheets/Manuals Printable datasheet for anti-LEFTY2 (ARP42107_P050) antibody
Sample Type Confirmation

LEFTY2 is supported by BioGPS gene expression data to be expressed in RPMI 8226

Target Reference Cornet,P.B., (2005) J. Clin. Endocrinol. Metab. 90 (2), 1001-1011
Gene Symbol LEFTY2
Official Gene Full Name Left-right determination factor 2
Alias Symbols EBAF, LEFTA, LEFTYA, MGC46222, TGFB4
NCBI Gene Id 7044
Protein Name Left-right determination factor 2
Description of Target LEFTY2 is a member of the TGF-beta family of proteins. The protein is secreted and plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in its gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of its gene in the endometrium.This gene encodes a member of the TGF-beta family of proteins. The encoded protein is secreted and plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in this gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of this gene in the endometrium. Alternative processing of this protein can yield three different products. This gene is closely linked to both a related family member and a related pseudogene.
Swissprot Id O00292
Protein Accession # NP_003231
Nucleotide Accession # NM_003240
Protein Size (# AA) 366
Molecular Weight 40kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LEFTY2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LEFTY2.
Protein Interactions ACSS3;
  1. What is the species homology for "LEFTY2 Antibody - N-terminal region (ARP42107_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Horse, Human, Mouse, Pig, Rat".

  2. How long will it take to receive "LEFTY2 Antibody - N-terminal region (ARP42107_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LEFTY2 Antibody - N-terminal region (ARP42107_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LEFTY2 Antibody - N-terminal region (ARP42107_P050)"?

    This target may also be called "EBAF, LEFTA, LEFTYA, MGC46222, TGFB4" in publications.

  5. What is the shipping cost for "LEFTY2 Antibody - N-terminal region (ARP42107_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LEFTY2 Antibody - N-terminal region (ARP42107_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LEFTY2 Antibody - N-terminal region (ARP42107_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "40kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LEFTY2 Antibody - N-terminal region (ARP42107_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "LEFTY2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LEFTY2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LEFTY2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LEFTY2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LEFTY2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LEFTY2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LEFTY2 Antibody - N-terminal region (ARP42107_P050)
Your Rating
We found other products you might like!