Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

LEFTY2 Antibody - N-terminal region (ARP42107_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42107_P050-FITC Conjugated

ARP42107_P050-HRP Conjugated

ARP42107_P050-Biotin Conjugated

Gene Symbol:
LEFTY2
Official Gene Full Name:
Left-right determination factor 2
NCBI Gene Id:
7044
Protein Name:
Left-right determination factor 2
Swissprot Id:
O00292
Protein Accession #:
NP_003231
Nucleotide Accession #:
NM_003240
Alias Symbols:
EBAF, LEFTA, LEFTYA, MGC46222, TGFB4
Replacement Item:
This antibody may replace item sc-115341 from Santa Cruz Biotechnology.
Description of Target:
LEFTY2 is a member of the TGF-beta family of proteins. The protein is secreted and plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in its gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of its gene in the endometrium.This gene encodes a member of the TGF-beta family of proteins. The encoded protein is secreted and plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in this gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of this gene in the endometrium. Alternative processing of this protein can yield three different products. This gene is closely linked to both a related family member and a related pseudogene.
Protein Size (# AA):
366
Molecular Weight:
40kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LEFTY2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LEFTY2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human LEFTY2
Predicted Species Reactivity:
Cow, Horse, Human, Mouse, Pig, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 86%; Rat: 83%
Complete computational species homology data:
Anti-LEFTY2 (ARP42107_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ACSS3;
Blocking Peptide:
For anti-LEFTY2 (ARP42107_P050) antibody is Catalog # AAP42107 (Previous Catalog # AAPP24586)
Datasheets/Manuals:
Printable datasheet for anti-LEFTY2 (ARP42107_P050) antibody
Sample Type Confirmation:

LEFTY2 is supported by BioGPS gene expression data to be expressed in RPMI 8226

Target Reference:
Cornet,P.B., (2005) J. Clin. Endocrinol. Metab. 90 (2), 1001-1011

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...