| Product Number |
ARP41562_T100 |
| Product Page |
www.avivasysbio.com/hmgcs2-antibody-n-terminal-region-arp41562-t100.html |
| Name |
HMGCS2 Antibody - N-terminal region (ARP41562_T100) |
| Protein Size (# AA) |
508 amino acids |
| Molecular Weight |
56kDa |
| NCBI Gene Id |
3158 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial) |
| Description |
|
| Peptide Sequence |
Synthetic peptide located within the following region: PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Bouchard,L., (2001) Pediatr. Res. 49 (3), 326-331 |
| Description of Target |
HMGCS2 condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase. |
| Protein Interactions |
UBC; APP; YWHAQ; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HMGCS2 (ARP41562_T100) antibody |
| Blocking Peptide |
For anti-HMGCS2 (ARP41562_T100) antibody is Catalog # AAP41562 (Previous Catalog # AAPP24247) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HMGCS2 |
| Uniprot ID |
P54868 |
| Protein Name |
Hydroxymethylglutaryl-CoA synthase, mitochondrial |
| Publications |
Diacylglycerol acyltransferase-1 inhibition enhances intestinal fatty acid oxidation and reduces energy intake in rats. J Lipid Res. 54, 1369-84 (2013). 23449193
Karimian Azari, E., Leitner, C., Jaggi, T., Langhans, W. & Mansouri, A. Possible role of intestinal fatty acid oxidation in the eating-inhibitory effect of the PPAR-a agonist Wy-14643 in high-fat diet fed rats. PLoS One 8, e74869 (2013). 24069361
Metabolic Adaptation of the Small Intestine to Short- and Medium-Term High-Fat Diet Exposure. J. Cell. Physiol. 232, 167-75 (2017). 27061934 |
| Protein Accession # |
NP_005509 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_005518 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HMGCS2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Fetal Liver
 | Host: Rabbit
Target Name: HMGCS2
Sample Tissue: Human Fetal Liver
Antibody Dilution: 1.0ug/ml |
|
