Search Antibody, Protein, and ELISA Kit Solutions

HMGCS2 antibody - N-terminal region (ARP41562_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41562_T100-FITC Conjugated

ARP41562_T100-HRP Conjugated

ARP41562_T100-Biotin Conjugated

Gene Symbol:
HMGCS2
NCBI Gene Id:
3158
Official Gene Full Name:
3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial)
Protein Name:
Hydroxymethylglutaryl-CoA synthase, mitochondrial
Swissprot Id:
P54868
Protein Accession #:
NP_005509
Nucleotide Accession #:
NM_005518
Replacement Item:
This antibody may replace item sc-121641 from Santa Cruz Biotechnology.
Description of Target:
HMGCS2 condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.
Protein Size (# AA):
508
Molecular Weight:
56kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HMGCS2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HMGCS2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human HMGCS2
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-HMGCS2 (ARP41562_T100)
Peptide Sequence:
Synthetic peptide located within the following region: PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; APP; YWHAQ;
Blocking Peptide:
For anti-HMGCS2 (ARP41562_T100) antibody is Catalog # AAP41562 (Previous Catalog # AAPP24247)
Datasheets/Manuals:
Printable datasheet for anti-HMGCS2 (ARP41562_T100) antibody
Target Reference:
Bouchard,L., (2001) Pediatr. Res. 49 (3), 326-331
Publications:

Karimian Azari, E., Leitner, C., Jaggi, T., Langhans, W. & Mansouri, A. Possible role of intestinal fatty acid oxidation in the eating-inhibitory effect of the PPAR--alpha agonist Wy-14643 in high-fat diet fed rats. PLoS One 8, e74869 (2013). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24069361

Clara, R; Schumacher, M; Ramachandran, D; Fedele, S; Krieger, JP; Langhans, W; Mansouri, A; Metabolic Adaptation of the Small Intestine to Short- and Medium-Term High-Fat Diet Exposure. 232, 167-75 (2017). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27061934

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...