Search Antibody, Protein, and ELISA Kit Solutions

HMGCS2 Antibody - N-terminal region (ARP41562_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41562_T100-FITC Conjugated

ARP41562_T100-HRP Conjugated

ARP41562_T100-Biotin Conjugated

Gene Symbol:
HMGCS2
Official Gene Full Name:
3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial)
NCBI Gene Id:
3158
Protein Name:
Hydroxymethylglutaryl-CoA synthase, mitochondrial
Swissprot Id:
P54868
Protein Accession #:
NP_005509
Nucleotide Accession #:
NM_005518
Replacement Item:
This antibody may replace item sc-121641 from Santa Cruz Biotechnology.
Description of Target:
HMGCS2 condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.
Protein Size (# AA):
508
Molecular Weight:
56kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HMGCS2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HMGCS2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human HMGCS2
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-HMGCS2 (ARP41562_T100)
Peptide Sequence:
Synthetic peptide located within the following region: PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; APP; YWHAQ;
Blocking Peptide:
For anti-HMGCS2 (ARP41562_T100) antibody is Catalog # AAP41562 (Previous Catalog # AAPP24247)
Datasheets/Manuals:
Printable datasheet for anti-HMGCS2 (ARP41562_T100) antibody
Target Reference:
Bouchard,L., (2001) Pediatr. Res. 49 (3), 326-331
Publications:

Clara, R; Schumacher, M; Ramachandran, D; Fedele, S; Krieger, JP; Langhans, W; Mansouri, A; Metabolic Adaptation of the Small Intestine to Short- and Medium-Term High-Fat Diet Exposure. 232, 167-75 (2017). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27061934

Karimian Azari, E., Leitner, C., Jaggi, T., Langhans, W. & Mansouri, A. Possible role of intestinal fatty acid oxidation in the eating-inhibitory effect of the PPAR-alpha agonist Wy-14643 in high-fat diet fed rats. PLoS One 8, e74869 (2013). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24069361

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...