SFTPB Antibody - middle region (ARP41411_P050)

• Product Number: ARP41411_P050
• Name: SFTPB Antibody - middle region (ARP41411_P050)
• Protein Size (# AA): 381 amino acids
• Molecular Weight: 42 kDa
• NCBI Gene Id: 6439
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Surfactant protein B
• Alias Symbols: SP-B, PSP-B, SFTB3, SFTP3, SMDP1
• Peptide Sequence: Synthetic peptide located within the following region: PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Garmany,T.H., (2008) Pediatr. Res. 63 (6), 645-649
• Description of Target: SFTPB is the pulmonary-associated surfactant B protein (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a lipid-rich material that prevents lung collapse by lowering surface tension at the air-liquid interface in the alveoli of lung. SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Surfactant is composed of phospholipids and other surfactant-associated proteins. See also SFTPA1, SFTPC, and SFTPD. The SFTPB gene encodes the pulmonary-associated surfactant B protein (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a lipid-rich material that prevents lung collapse by lowering surface tension at the air-liquid interface in the alveoli of lung. SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Surfactant is composed of phospholipids and other surfactant-associated proteins (Clark et al., 1995 [PubMed 7644495]). See also SFTPA1 (MIM 178630), SFTPC (MIM 178620), and SFTPD (MIM 178635).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: CTSH;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-SFTPB (ARP41411_P050) antibody is Catalog # AAP41411 (Previous Catalog # AAPP24149)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SFTPB
• Uniprot ID: P07988
• Protein Name: Pulmonary surfactant-associated protein B
• Protein Accession #: NP_000533
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000542
• Tested Species Reactivity: Human, Mouse, Rat
• Gene Symbol: SFTPB
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rabbit: 85%; Rat: 100%; Sheep: 79%
• Image 1: Human 721_B
  
  WB Suggested Anti-SFTPB Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: 721_B cell lysate
• Image 2: Human MCF7 Whole Cell
  
  Host: Rabbit
  Target Name: SFTPB
  Sample Tissue: Human MCF7 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 3: Human Lung Tissue
  
  SFTPB antibody - middle region (ARP41411_P050)
  Catalog Number: ARP41411_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
  Observed Staining: Cytoplasm and membrane of pneumocytes
  Primary Antibody Concentration: 1:600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
• Image 4: Mouse Liver
  
  Host: Mouse
  Target Name: SFTPB
  Sample Tissue: Mouse Liver
  Antibody Dilution: 1ug/ml