Search Antibody, Protein, and ELISA Kit Solutions

SFTPB Antibody - middle region (ARP41411_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41411_P050-FITC Conjugated

ARP41411_P050-HRP Conjugated

ARP41411_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-115028 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human SFTPB
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rabbit: 85%; Rat: 100%; Sheep: 79%
Complete computational species homology data:
Anti-SFTPB (ARP41411_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SFTPB (ARP41411_P050) antibody is Catalog # AAP41411 (Previous Catalog # AAPP24149)
Printable datasheet for anti-SFTPB (ARP41411_P050) antibody
Target Reference:
Garmany,T.H., (2008) Pediatr. Res. 63 (6), 645-649
Gene Symbol:
Official Gene Full Name:
Surfactant protein B
Alias Symbols:
NCBI Gene Id:
Protein Name:
Pulmonary surfactant-associated protein B
Description of Target:
SFTPB is the pulmonary-associated surfactant B protein (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a lipid-rich material that prevents lung collapse by lowering surface tension at the air-liquid interface in the alveoli of lung. SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Surfactant is composed of phospholipids and other surfactant-associated proteins. See also SFTPA1, SFTPC, and SFTPD. The SFTPB gene encodes the pulmonary-associated surfactant B protein (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a lipid-rich material that prevents lung collapse by lowering surface tension at the air-liquid interface in the alveoli of lung. SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Surfactant is composed of phospholipids and other surfactant-associated proteins (Clark et al., 1995 [PubMed 7644495]). See also SFTPA1 (MIM 178630), SFTPC (MIM 178620), and SFTPD (MIM 178635).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SFTPB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SFTPB.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...