HNRPLL Antibody - N-terminal region (ARP41102_T100)

Data Sheet
 
Product Number ARP41102_T100
Product Page www.avivasysbio.com/hnrpll-antibody-n-terminal-region-arp41102-t100.html
Name HNRPLL Antibody - N-terminal region (ARP41102_T100)
Gene Symbol HNRNPLL
Alias Symbols SRRF, hnRNPLL, HNRPLL
Protein Size (# AA) 542 amino acids
Molecular Weight 60kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 92906
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Heterogeneous nuclear ribonucleoprotein L-like
Peptide Sequence Synthetic peptide located within the following region: RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS
Target Reference Shur,I., Gene 334, 113-121 (2004)
Description of Target HNRPLL contains 3 RRM (RNA recognition motif) domains and may bind RNA and plays a role in mRNA processing.
Protein Interactions HNRNPK; HNRNPLL; RHOXF2; BOLL; THAP1; RBPMS; QKI; UBE2I; MDFI; DAB1; UBC; ATXN1; PAXIP1; BARD1; CNOT3; PCBP1; SUMO2; VHL; PSMA3; HDAC5; DDX39B;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HNRNPLL (ARP41102_T100) antibody
Blocking Peptide For anti-HNRNPLL (ARP41102_T100) antibody is Catalog # AAP41102 (Previous Catalog # AAPS02211)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPLL
Complete computational species homology data Anti-HNRPLL (ARP41102_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HNRPLL.
Swissprot Id Q8WVV9
Protein Name Heterogeneous nuclear ribonucleoprotein L-like
Publications

Heyd, F. & Lynch, K. W. Phosphorylation-dependent regulation of PSF by GSK3 controls CD45 alternative splicing. Mol. Cell 40, 126-37 (2010). IHC, WB, Cow, Dog, Guinea Pig, Human, Rabbit 20932480

Liu, G., Lei, L., Yu, J., Kung, S. & Xie, J. Refinement of the spectra of exon usage by combined effects of extracellular stimulus and intracellular factors. Biochim. Biophys. Acta 1839, 537-45 (2014). IHC, WB, Cow, Dog, Guinea Pig, Human, Rabbit 24844182

Rajan, P. et al. Proteomic identification of heterogeneous nuclear ribonucleoprotein L as a novel component of SLM/Sam68 Nuclear Bodies. BMC Cell Biol. 10, 82 (2009). IHC, WB, Cow, Dog, Guinea Pig, Human, Rabbit 19912651

Yu, J. et al. The heterogeneous nuclear ribonucleoprotein L is an essential component in the Ca2+/calmodulin-dependent protein kinase IV-regulated alternative splicing through cytidine-adenosine repeats. J. Biol. Chem. 284, 1505-13 (2009). IHC, WB, Cow, Dog, Guinea Pig, Human, Rabbit 19017650

Protein Accession # NP_612403
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HNRPLL.
Nucleotide Accession # NM_138394
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Rabbit: 100%
Image 1
Human HepG2
WB Suggested Anti-HNRPLL Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
Image 2
Human Heart
Rabbit Anti-HNRPLL Antibody
Catalog Number: ARP41102
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 3
Human lung
Rabbit Anti-HNRPLL Antibody
Catalog Number: ARP41102
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 4
HepG2
Host: Rabbit
Target Name: HNRPLL
Sample Type: HepG2
Lane A: Primary Antibody
Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 2.5ug/mL
Peptide Concentration: 2.0ug/mL
Lysate Quantity: 25ug/lane
Gel Concentration: 12%
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com