Size:100 ul
$229.00
In Stock
SKU
ARP41102_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41102_T100-FITC Conjugated

ARP41102_T100-HRP Conjugated

ARP41102_T100-Biotin Conjugated

HNRPLL Antibody - N-terminal region (ARP41102_T100)

Catalog#: ARP41102_T100
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Rabbit
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPLL
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Rabbit: 100%
Complete computational species homology data Anti-HNRPLL (ARP41102_T100)
Peptide Sequence Synthetic peptide located within the following region: RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HNRNPLL (ARP41102_T100) antibody is Catalog # AAP41102 (Previous Catalog # AAPS02211)
Datasheets/Manuals Printable datasheet for anti-HNRNPLL (ARP41102_T100) antibody
Target Reference Shur,I., Gene 334, 113-121 (2004)
Publications

Heyd, F. & Lynch, K. W. Phosphorylation-dependent regulation of PSF by GSK3 controls CD45 alternative splicing. Mol. Cell 40, 126-37 (2010). IHC, WB, Cow, Dog, Guinea Pig, Human, Rabbit 20932480

Liu, G., Lei, L., Yu, J., Kung, S. & Xie, J. Refinement of the spectra of exon usage by combined effects of extracellular stimulus and intracellular factors. Biochim. Biophys. Acta 1839, 537-45 (2014). IHC, WB, Cow, Dog, Guinea Pig, Human, Rabbit 24844182

Rajan, P. et al. Proteomic identification of heterogeneous nuclear ribonucleoprotein L as a novel component of SLM/Sam68 Nuclear Bodies. BMC Cell Biol. 10, 82 (2009). IHC, WB, Cow, Dog, Guinea Pig, Human, Rabbit 19912651

Yu, J. et al. The heterogeneous nuclear ribonucleoprotein L is an essential component in the Ca2+/calmodulin-dependent protein kinase IV-regulated alternative splicing through cytidine-adenosine repeats. J. Biol. Chem. 284, 1505-13 (2009). IHC, WB, Cow, Dog, Guinea Pig, Human, Rabbit 19017650

Gene Symbol HNRNPLL
Official Gene Full Name Heterogeneous nuclear ribonucleoprotein L-like
Alias Symbols SRRF, hnRNPLL, HNRPLL
NCBI Gene Id 92906
Protein Name Heterogeneous nuclear ribonucleoprotein L-like
Description of Target HNRPLL contains 3 RRM (RNA recognition motif) domains and may bind RNA and plays a role in mRNA processing.
Swissprot Id Q8WVV9
Protein Accession # NP_612403
Nucleotide Accession # NM_138394
Protein Size (# AA) 542
Molecular Weight 60kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HNRPLL.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HNRPLL.
Protein Interactions HNRNPK; HNRNPLL; RHOXF2; BOLL; THAP1; RBPMS; QKI; UBE2I; MDFI; DAB1; UBC; ATXN1; PAXIP1; BARD1; CNOT3; PCBP1; SUMO2; VHL; PSMA3; HDAC5; DDX39B;
  1. What is the species homology for "HNRPLL Antibody - N-terminal region (ARP41102_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Human, Rabbit".

  2. How long will it take to receive "HNRPLL Antibody - N-terminal region (ARP41102_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HNRPLL Antibody - N-terminal region (ARP41102_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HNRPLL Antibody - N-terminal region (ARP41102_T100)"?

    This target may also be called "SRRF, hnRNPLL, HNRPLL" in publications.

  5. What is the shipping cost for "HNRPLL Antibody - N-terminal region (ARP41102_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HNRPLL Antibody - N-terminal region (ARP41102_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HNRPLL Antibody - N-terminal region (ARP41102_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "60kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HNRPLL Antibody - N-terminal region (ARP41102_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HNRNPLL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HNRNPLL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HNRNPLL"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HNRNPLL"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HNRNPLL"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HNRNPLL"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HNRPLL Antibody - N-terminal region (ARP41102_T100)
Your Rating
We found other products you might like!