Size:100 ul
$229.00
In stock
SKU
ARP41102_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41102_T100-FITC Conjugated

ARP41102_T100-HRP Conjugated

ARP41102_T100-Biotin Conjugated

HNRPLL Antibody - N-terminal region (ARP41102_T100)

Catalog#: ARP41102_T100
Domestic: within 1-2 days delivery International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Rabbit
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPLL
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Rabbit: 100%
Complete computational species homology data Anti-HNRPLL (ARP41102_T100)
Peptide Sequence Synthetic peptide located within the following region: RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HNRNPLL (ARP41102_T100) antibody is Catalog # AAP41102 (Previous Catalog # AAPS02211)
Datasheets/Manuals Printable datasheet for anti-HNRNPLL (ARP41102_T100) antibody
Target Reference Shur,I., Gene 334, 113-121 (2004)
Publications

Heyd, F. & Lynch, K. W. Phosphorylation-dependent regulation of PSF by GSK3 controls CD45 alternative splicing. Mol. Cell 40, 126-37 (2010). IHC, WB, Cow, Dog, Guinea Pig, Human, Rabbit 20932480

Liu, G., Lei, L., Yu, J., Kung, S. & Xie, J. Refinement of the spectra of exon usage by combined effects of extracellular stimulus and intracellular factors. Biochim. Biophys. Acta 1839, 537-45 (2014). IHC, WB, Cow, Dog, Guinea Pig, Human, Rabbit 24844182

Rajan, P. et al. Proteomic identification of heterogeneous nuclear ribonucleoprotein L as a novel component of SLM/Sam68 Nuclear Bodies. BMC Cell Biol. 10, 82 (2009). IHC, WB, Cow, Dog, Guinea Pig, Human, Rabbit 19912651

Yu, J. et al. The heterogeneous nuclear ribonucleoprotein L is an essential component in the Ca2+/calmodulin-dependent protein kinase IV-regulated alternative splicing through cytidine-adenosine repeats. J. Biol. Chem. 284, 1505-13 (2009). IHC, WB, Cow, Dog, Guinea Pig, Human, Rabbit 19017650

Gene Symbol HNRNPLL
Official Gene Full Name Heterogeneous nuclear ribonucleoprotein L-like
Alias Symbols SRRF, hnRNPLL, HNRPLL
NCBI Gene Id 92906
Protein Name Heterogeneous nuclear ribonucleoprotein L-like
Description of Target HNRPLL contains 3 RRM (RNA recognition motif) domains and may bind RNA and plays a role in mRNA processing.
Swissprot Id Q8WVV9
Protein Accession # NP_612403
Nucleotide Accession # NM_138394
Protein Size (# AA) 542
Molecular Weight 60kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HNRPLL.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HNRPLL.
Protein Interactions HNRNPK; HNRNPLL; RHOXF2; BOLL; THAP1; RBPMS; QKI; UBE2I; MDFI; DAB1; UBC; ATXN1; PAXIP1; BARD1; CNOT3; PCBP1; SUMO2; VHL; PSMA3; HDAC5; DDX39B;
Write Your Own Review
You're reviewing:HNRPLL Antibody - N-terminal region (ARP41102_T100)
Your Rating