Search Antibody, Protein, and ELISA Kit Solutions

HNRPLL antibody - N-terminal region (ARP41102_T100)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41102_T100-FITC Conjugated

ARP41102_T100-HRP Conjugated

ARP41102_T100-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Heterogeneous nuclear ribonucleoprotein L-like
Protein Name:
Heterogeneous nuclear ribonucleoprotein L-like
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
HNRPLL contains 3 RRM (RNA recognition motif) domains and may bind RNA and plays a role in mRNA processing.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HNRPLL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HNRPLL.
The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPLL
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Rabbit: 100%
Complete computational species homology data:
Anti-HNRPLL (ARP41102_T100)
Peptide Sequence:
Synthetic peptide located within the following region: RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HNRNPLL (ARP41102_T100) antibody is Catalog # AAP41102 (Previous Catalog # AAPS02211)
Printable datasheet for anti-HNRNPLL (ARP41102_T100) antibody
Target Reference:
Shur,I., Gene 334, 113-121 (2004)

Liu, G., Lei, L., Yu, J., Kung, S. & Xie, J. Refinement of the spectra of exon usage by combined effects of extracellular stimulus and intracellular factors. Biochim. Biophys. Acta 1839, 537-45 (2014). IHC, WB, Cow, Dog, Guinea Pig, Human, Rabbit 24844182

Yu, J. et al. The heterogeneous nuclear ribonucleoprotein L is an essential component in the Ca2+/calmodulin-dependent protein kinase IV-regulated alternative splicing through cytidine-adenosine repeats. J. Biol. Chem. 284, 1505-13 (2009). IHC, WB, Cow, Dog, Guinea Pig, Human, Rabbit 19017650

Rajan, P. et al. Proteomic identification of heterogeneous nuclear ribonucleoprotein L as a novel component of SLM/Sam68 Nuclear Bodies. BMC Cell Biol. 10, 82 (2009). IHC, WB, Cow, Dog, Guinea Pig, Human, Rabbit 19912651

Heyd, F. & Lynch, K. W. Phosphorylation-dependent regulation of PSF by GSK3 controls CD45 alternative splicing. Mol. Cell 40, 126-37 (2010). IHC, WB, Cow, Dog, Guinea Pig, Human, Rabbit 20932480

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...