NONO Antibody - C-terminal region (ARP40716_T100)

Data Sheet
 
Product Number ARP40716_T100
Product Page www.avivasysbio.com/nono-antibody-c-terminal-region-arp40716-t100.html
Name NONO Antibody - C-terminal region (ARP40716_T100)
Protein Size (# AA) 471 amino acids
Molecular Weight 52kDa
NCBI Gene Id 4841
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Non-POU domain containing, octamer-binding
Alias Symbols P54, NMT55, NRB54, MRXS34, P54NRB, PPP1R114
Peptide Sequence Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kimura,K., (2006) Genome Res. 16 (1), 55-65
Description of Target NONO is DNA- and RNA binding protein, involved in several nuclear processes. It binds the conventional octamer sequence in double stranded DNA. It also binds single-stranded DNA and RNA at a site independent of the duplex site. It is involved in pre-mRNA splicing and interacts with U5 snRNA. The SFPQ-NONO heteromer associated with MATR3 may play a role in nuclear retention of defective RNAs, be involved in DNA unwinding by modulating the function of topoisomerase I/TOP1 and be involved in DNA nonhomologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination and may stabilize paired DNA ends. NONO binds to an enhancer element in long terminal repeats of endogenous intracisternal A particles (IAPs) and activates transcription.
Protein Interactions SFPQ; PTBP1; PRKAA2; PIN1; NONO; FUS; DDX6; C11orf68; PSPC1; HUWE1; LMO4; UBC; SUMO2; STAU1; MDM2; RPA3; RPA2; RPA1; ASB18; WWOX; ASB3; ERG; EED; rev; WBP4; TCERG1; APBB1; PRPF40A; LMNA; CD81; PAN2; CTNNB1; ORC5; MYC; ITGA4; IL7R; FN1; EWSR1; YLPM1; RNF43
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NONO (ARP40716_T100) antibody
Blocking Peptide For anti-NONO (ARP40716_T100) antibody is Catalog # AAP40716 (Previous Catalog # AAPP10454)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human NONO
Uniprot ID Q15233
Protein Name Non-POU domain-containing octamer-binding protein
Protein Accession # NP_031389
Purification Protein A purified
Nucleotide Accession # NM_007363
Tested Species Reactivity Human
Gene Symbol NONO
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IF, IHC, WB, IP
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-NONO Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Image 2
subnuclear bodies
Sample Type : subnuclear bodies-paraspeckles
Image 3
Human kidney
Human kidney
Image 4
Human Liver
Human Liver
Image 5
HEK293 Whole Cell Lysate
NONO was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with ARP40716_T100 with 1:200 dilution. Western blot was performed using ARP40716_T100 at 1/1000 dilution.
Lane 1: Control IP in HEK293 Whole Cell Lysate.
Lane 2: NONO IP with ARP40716_T100 in HEK293 Whole Cell Lysate.
Lane 3: Input of HEK293 Whole Cell Lysate.
Image 6
Human Heart
Rabbit Anti-NONO Antibody
Catalog Number: ARP40716
Paraffin Embedded Tissue: Human cardiac cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 7
Human Heart
Rabbit Anti-NONO Antibody
Catalog Number: ARP40716
Paraffin Embedded Tissue: Human cardiac cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com