| Product Number |
ARP40392_T100 |
| Product Page |
www.avivasysbio.com/isg20-antibody-n-terminal-region-arp40392-t100.html |
| Name |
ISG20 Antibody - N-terminal region (ARP40392_T100) |
| Protein Size (# AA) |
181 amino acids |
| Molecular Weight |
20kDa |
| NCBI Gene Id |
3669 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Interferon stimulated exonuclease gene 20kDa |
| Alias Symbols |
CD25, HEM45 |
| Peptide Sequence |
Synthetic peptide located within the following region: GAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLLKGK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Horio,T., FEBS Lett. 577 (1-2), 111-116 (2004) |
| Description of Target |
ISG20 belongs to the the exonuclease superfamily. It is exonuclease with specificity for single-stranded RNA and, to a lesser extent for DNA. It degrades RNA at a rate that is approximately 35-fold higher than its rate for single-stranded DNA. It is involved in the antiviral function of IFN against RNA viruses. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ISG20 (ARP40392_T100) antibody |
| Blocking Peptide |
For anti-ISG20 (ARP40392_T100) antibody is Catalog # AAP40392 (Previous Catalog # AAPP22136) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ISG20 |
| Uniprot ID |
Q96AZ6 |
| Protein Name |
Interferon-stimulated gene 20 kDa protein |
| Publications |
Zahoor, M. A. et al. HIV-1 Vpr Induces Interferon-Stimulated Genes in Human Monocyte-Derived Macrophages. PLoS One 9, e106418 (2014). 25170834 |
| Sample Type Confirmation |
ISG20 is strongly supported by BioGPS gene expression data to be expressed in Daudi |
| Protein Accession # |
NP_002192 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_002201 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ISG20 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93% |
| Image 1 | Human Daudi
 | WB Suggested Anti-ISG20 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Daudi cell lysateISG20 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells |
|
