Search Antibody, Protein, and ELISA Kit Solutions

ISG20 Antibody - N-terminal region (ARP40392_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40392_T100-FITC Conjugated

ARP40392_T100-HRP Conjugated

ARP40392_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Interferon stimulated exonuclease gene 20kDa
NCBI Gene Id:
Protein Name:
Interferon-stimulated gene 20 kDa protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CD25, HEM45
Replacement Item:
This antibody may replace item sc-34109 from Santa Cruz Biotechnology.
Description of Target:
ISG20 belongs to the the exonuclease superfamily. It is exonuclease with specificity for single-stranded RNA and, to a lesser extent for DNA. It degrades RNA at a rate that is approximately 35-fold higher than its rate for single-stranded DNA. It is involved in the antiviral function of IFN against RNA viruses.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ISG20.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ISG20.
The immunogen is a synthetic peptide directed towards the N terminal region of human ISG20
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-ISG20 (ARP40392_T100)
Peptide Sequence:
Synthetic peptide located within the following region: GAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLLKGK
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ISG20 (ARP40392_T100) antibody is Catalog # AAP40392 (Previous Catalog # AAPP22136)
Printable datasheet for anti-ISG20 (ARP40392_T100) antibody
Sample Type Confirmation:

ISG20 is strongly supported by BioGPS gene expression data to be expressed in Daudi

Target Reference:
Horio,T., FEBS Lett. 577 (1-2), 111-116 (2004)

Zahoor, M. A. et al. HIV-1 Vpr Induces Interferon-Stimulated Genes in Human Monocyte-Derived Macrophages. PLoS One 9, e106418 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 25170834

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...