Size:100 ul
$229.00
In Stock
SKU
ARP40392_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40392_T100-FITC Conjugated

ARP40392_T100-HRP Conjugated

ARP40392_T100-Biotin Conjugated

ISG20 Antibody - N-terminal region (ARP40392_T100)

Catalog#: ARP40392_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-34109 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ISG20
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%
Complete computational species homology data Anti-ISG20 (ARP40392_T100)
Peptide Sequence Synthetic peptide located within the following region: GAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLLKGK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ISG20 (ARP40392_T100) antibody is Catalog # AAP40392 (Previous Catalog # AAPP22136)
Datasheets/Manuals Printable datasheet for anti-ISG20 (ARP40392_T100) antibody
Sample Type Confirmation

ISG20 is strongly supported by BioGPS gene expression data to be expressed in Daudi

Target Reference Horio,T., FEBS Lett. 577 (1-2), 111-116 (2004)
Publications

Zahoor, M. A. et al. HIV-1 Vpr Induces Interferon-Stimulated Genes in Human Monocyte-Derived Macrophages. PLoS One 9, e106418 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 25170834

Gene Symbol ISG20
Official Gene Full Name Interferon stimulated exonuclease gene 20kDa
Alias Symbols CD25, HEM45
NCBI Gene Id 3669
Protein Name Interferon-stimulated gene 20 kDa protein
Description of Target ISG20 belongs to the the exonuclease superfamily. It is exonuclease with specificity for single-stranded RNA and, to a lesser extent for DNA. It degrades RNA at a rate that is approximately 35-fold higher than its rate for single-stranded DNA. It is involved in the antiviral function of IFN against RNA viruses.
Swissprot Id Q96AZ6
Protein Accession # NP_002192
Nucleotide Accession # NM_002201
Protein Size (# AA) 181
Molecular Weight 20kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ISG20.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ISG20.
Protein Interactions UBC;
  1. What is the species homology for "ISG20 Antibody - N-terminal region (ARP40392_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "ISG20 Antibody - N-terminal region (ARP40392_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ISG20 Antibody - N-terminal region (ARP40392_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ISG20 Antibody - N-terminal region (ARP40392_T100)"?

    This target may also be called "CD25, HEM45" in publications.

  5. What is the shipping cost for "ISG20 Antibody - N-terminal region (ARP40392_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ISG20 Antibody - N-terminal region (ARP40392_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ISG20 Antibody - N-terminal region (ARP40392_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "20kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ISG20 Antibody - N-terminal region (ARP40392_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ISG20"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ISG20"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ISG20"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ISG20"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ISG20"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ISG20"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ISG20 Antibody - N-terminal region (ARP40392_T100)
Your Rating
We found other products you might like!