HOXA9 Antibody - middle region : Biotin (ARP39932_P050-Biotin)

Data Sheet
 
Product Number ARP39932_P050-Biotin
Product Page www.avivasysbio.com/hoxa9-antibody-middle-region-biotin-arp39932-p050-biotin.html
Name HOXA9 Antibody - middle region : Biotin (ARP39932_P050-Biotin)
Protein Size (# AA) 272 amino acids
Molecular Weight 30kDa
Conjugation Biotin
NCBI Gene Id 3205
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Homeobox A9
Alias Symbols HOX1, ABD-B, HOX1G, HOX1.7
Peptide Sequence Synthetic peptide located within the following region: KEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference Whelan,J.T., (2008) Leukemia 22 (6), 1161-1169
Description of Target In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA9 gene is part of the A cluster on chromosome 7 and the protein is a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to the abdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and the NUP98 gene has been associated with myeloid leukemogenesis.In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to the abdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and the NUP98 gene has been associated with myeloid leukemogenesis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions TRIP6; PRMT5; CUL4A; UBC; CREBBP; PBX3; RBPMS; PBX2; PBX1; PLSCR1; MEIS2; MEIS1; SMAD2; SMAD4; JUN; NFKBIA; BCR; KMT2A;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-HOXA9 (ARP39932_P050-Biotin) antibody
Blocking Peptide For anti-HOXA9 (ARP39932_P050-Biotin) antibody is Catalog # AAP39932 (Previous Catalog # AAPP23235)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HOXA9
Uniprot ID P31269
Protein Name Homeobox protein Hox-A9
Publications

Wang, L. et al. BRCA1 is a negative modulator of the PRC2 complex. EMBO J. 32, 1584-97 (2013). WB, Horse, Rabbit, Rat, Human, Dog, Pig, Guinea pig, Mouse, Zebrafish, Bovine, Sheep 23624935

Protein Accession # NP_689952
Purification Affinity Purified
Nucleotide Accession # NM_152739
Gene Symbol HOXA9
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 85%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 85%; Zebrafish: 93%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com