Product Number |
ARP39932_P050-Biotin |
Product Page |
www.avivasysbio.com/hoxa9-antibody-middle-region-biotin-arp39932-p050-biotin.html |
Name |
HOXA9 Antibody - middle region : Biotin (ARP39932_P050-Biotin) |
Protein Size (# AA) |
272 amino acids |
Molecular Weight |
30kDa |
Conjugation |
Biotin |
NCBI Gene Id |
3205 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Homeobox A9 |
Alias Symbols |
HOX1, ABD-B, HOX1G, HOX1.7 |
Peptide Sequence |
Synthetic peptide located within the following region: KEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Reference |
Whelan,J.T., (2008) Leukemia 22 (6), 1161-1169 |
Description of Target |
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA9 gene is part of the A cluster on chromosome 7 and the protein is a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to the abdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and the NUP98 gene has been associated with myeloid leukemogenesis.In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to the abdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and the NUP98 gene has been associated with myeloid leukemogenesis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Protein Interactions |
TRIP6; PRMT5; CUL4A; UBC; CREBBP; PBX3; RBPMS; PBX2; PBX1; PLSCR1; MEIS2; MEIS1; SMAD2; SMAD4; JUN; NFKBIA; BCR; KMT2A; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-HOXA9 (ARP39932_P050-Biotin) antibody |
Blocking Peptide |
For anti-HOXA9 (ARP39932_P050-Biotin) antibody is Catalog # AAP39932 (Previous Catalog # AAPP23235) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human HOXA9 |
Uniprot ID |
P31269 |
Protein Name |
Homeobox protein Hox-A9 |
Publications |
Wang, L. et al. BRCA1 is a negative modulator of the PRC2 complex. EMBO J. 32, 1584-97 (2013). WB, Horse, Rabbit, Rat, Human, Dog, Pig, Guinea pig, Mouse, Zebrafish, Bovine, Sheep 23624935 |
Protein Accession # |
NP_689952 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_152739 |
Gene Symbol |
HOXA9 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 85%; Zebrafish: 93% |
Image 1 | |
|