Size:100 ul
$319.00
In Stock
SKU
ARP39932_P050-Biotin
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP39932_P050 Unconjugated

ARP39932_P050-FITC Conjugated

ARP39932_P050-HRP Conjugated

HOXA9 Antibody - middle region : Biotin (ARP39932_P050-Biotin)

Catalog#: ARP39932_P050-Biotin
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation Biotin
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-17155 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HOXA9
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 85%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 85%; Zebrafish: 93%
Complete computational species homology data Anti-HOXA9 (ARP39932_P050)
Peptide Sequence Synthetic peptide located within the following region: KEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE
Concentration 0.5 mg/ml
Blocking Peptide For anti-HOXA9 (ARP39932_P050-Biotin) antibody is Catalog # AAP39932 (Previous Catalog # AAPP23235)
Datasheets/Manuals Printable datasheet for anti-HOXA9 (ARP39932_P050-Biotin) antibody
Target Reference Whelan,J.T., (2008) Leukemia 22 (6), 1161-1169
Publications

Wang, L. et al. BRCA1 is a negative modulator of the PRC2 complex. EMBO J. 32, 1584-97 (2013). WB, Horse, Rabbit, Rat, Human, Dog, Pig, Guinea pig, Mouse, Zebrafish, Bovine, Sheep 23624935

Gene Symbol HOXA9
Official Gene Full Name Homeobox A9
Alias Symbols ABD-B, HOX1, HOX1.7, HOX1G, MGC1934
NCBI Gene Id 3205
Protein Name Homeobox protein Hox-A9
Description of Target In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA9 gene is part of the A cluster on chromosome 7 and the protein is a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to the abdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and the NUP98 gene has been associated with myeloid leukemogenesis.In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to the abdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and the NUP98 gene has been associated with myeloid leukemogenesis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P31269
Protein Accession # NP_689952
Nucleotide Accession # NM_152739
Protein Size (# AA) 272
Molecular Weight 30kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HOXA9.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HOXA9.
Protein Interactions TRIP6; PRMT5; CUL4A; UBC; CREBBP; PBX3; RBPMS; PBX2; PBX1; PLSCR1; MEIS2; MEIS1; SMAD2; SMAD4; JUN; NFKBIA; BCR; KMT2A;
  1. What is the species homology for "HOXA9 Antibody - middle region : Biotin (ARP39932_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish".

  2. How long will it take to receive "HOXA9 Antibody - middle region : Biotin (ARP39932_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HOXA9 Antibody - middle region : Biotin (ARP39932_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HOXA9 Antibody - middle region : Biotin (ARP39932_P050-Biotin)"?

    This target may also be called "ABD-B, HOX1, HOX1.7, HOX1G, MGC1934" in publications.

  5. What is the shipping cost for "HOXA9 Antibody - middle region : Biotin (ARP39932_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HOXA9 Antibody - middle region : Biotin (ARP39932_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HOXA9 Antibody - middle region : Biotin (ARP39932_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "30kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HOXA9 Antibody - middle region : Biotin (ARP39932_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HOXA9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HOXA9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HOXA9"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HOXA9"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HOXA9"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HOXA9"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HOXA9 Antibody - middle region : Biotin (ARP39932_P050-Biotin)
Your Rating
We found other products you might like!