CBLL1 Antibody - C-terminal region (ARP39623_T100)

• Product Number: ARP39623_T100
• Name: CBLL1 Antibody - C-terminal region (ARP39623_T100)
• Protein Size (# AA): 491 amino acids
• Molecular Weight: 55kDa
• NCBI Gene Id: 79872
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Cbl proto-oncogene, E3 ubiquitin protein ligase-like 1
• Description:
  View product citations for CBLL1 Antibody - C-terminal region (ARP39623_T100) on CiteAb
• Alias Symbols: HAKAI, RNF188
• Peptide Sequence: Synthetic peptide located within the following region: PFTQPGGMSPGIWPAPRGPPPPPRLQGPPSQTPLPGPHHPDQTRYRPYYQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Strausberg,R.L., (2004) J. Cell. Sci. 117 (PT 7), 989-998
• Description of Target: Epithelial cell cadherin is endocytosed as a consequence of tyrosine phosphorylation and ubiquitination. CBLL1 is an E3 ubiquitin ligase that mediates ubiquitination of the CDH1 complex.Epithelial cell cadherin (CDH1; MIM 192090) is endocytosed as a consequence of tyrosine phosphorylation and ubiquitination. HAKAI is an E3 ubiquitin ligase (see UBE3A; MIM 601623) that mediates ubiquitination of the CDH1 complex.[supplied by OMIM].
• Protein Interactions: DGCR6; SUMO1; UBC; CDH1; RNF2; YWHAQ; SFPQ; Cbll1; ESR1; CTTN; DOK1; SRC; CDC42;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CBLL1 (ARP39623_T100) antibody is Catalog # AAP39623 (Previous Catalog # AAPP21643)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CBLL1
• Uniprot ID: Q75N03
• Protein Name: E3 ubiquitin-protein ligase Hakai
• Publications:

  Horiuchi, K. et al. Identification of Wilms’ Tumor 1-associating Protein Complex and Its Role in Alternative Splicing and the Cell Cycle. J. Biol. Chem. 288, 33292-302 (2013). 24100041

  Wilms' tumor 1-associating protein complex regulates alternative splicing and polyadenylation at potential G-quadruplex-forming splice site sequences. J Biol Chem. 297, 101248 (2021). 34582888

• Protein Accession #: NP_079090
• Purification: Protein A purified
• Nucleotide Accession #: NM_024814
• Tested Species Reactivity: Human
• Gene Symbol: CBLL1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%; Zebrafish: 93%
• Image 1: Human Jurkat
  
  Host: Rabbit
  Target Name: CBLL1
  Sample Tissue: Human Jurkat
  Antibody Dilution: 1.0ug/ml