FOXM1 Antibody - middle region (ARP39519_P050)

Data Sheet
 
Product Number ARP39519_P050
Product Page www.avivasysbio.com/foxm1-antibody-middle-region-arp39519-p050.html
Name FOXM1 Antibody - middle region (ARP39519_P050)
Protein Size (# AA) 763 amino acids
Molecular Weight 84kDa
NCBI Gene Id 2305
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Forkhead box M1
Alias Symbols MPP2, HFH11, HNF-3, INS-1, MPP-2, PIG29, FKHL16, FOXM1A, FOXM1B, FOXM1C, HFH-11, TRIDENT, MPHOSPH2
Peptide Sequence Synthetic peptide located within the following region: ANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Laoukili,J., (2008) Mol. Cell. Biol. 28 (9), 3076-3087
Description of Target This protein acts as a Transcriptional activatory factor. May play a role in the control of cell proliferation.
Protein Interactions SMAD3; FZR1; SUMO1; UBE2I; SP1; CDK2; CCNE1; BANP; OS9; HSP90AA1; CDK6; CDK4; DHX29; ACAT1; CDC27; UBC; BCL6; SUMO2; RB1; CREBBP; CDC25B; CDK1; CCNB1; ZBTB3; CHEK2; STAT3; CDH1; CENPF;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FOXM1 (ARP39519_P050) antibody
Blocking Peptide For anti-FOXM1 (ARP39519_P050) antibody is Catalog # AAP39519 (Previous Catalog # AAPP21535)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FOXM1
Uniprot ID Q08050
Protein Name Forkhead box protein M1
Publications

Hu, C. et al. LXRa-mediated downregulation of FOXM1 suppresses the proliferation of hepatocellular carcinoma cells. Oncogene (2013). doi:10.1038/onc.2013.250 23812424

Protein Accession # NP_068772
Purification Affinity Purified
Nucleotide Accession # NM_021953
Tested Species Reactivity Human
Gene Symbol FOXM1
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 79%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Image 1
Transfected 293T
WB Suggested Anti-FOXM1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T
Image 2
Human
Lanes:
Lane 1: 25ug MIA PaCa-2 human pancreatic cancer cell line)
Lane 2: 25ug MDA-MB-231 cell lysate
Lane 3: 25ug Huh-7 cell lysate
Primary Antibody Dilution:
1:2000
Secondary Antibody:
Anti-rabbit-HRP
Secondary Antibody Dilution:
1:5000
Gene Name:
FOXM1
Submitted by:
Andrei L. Gartel, University of Illinois at Chicago
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com