| Product Number |
ARP39071_P050-HRP |
| Product Page |
www.avivasysbio.com/rbpjl-antibody-n-terminal-region-hrp-arp39071-p050-hrp.html |
| Name |
RBPJL Antibody - N-terminal region : HRP (ARP39071_P050-HRP) |
| Protein Size (# AA) |
516 amino acids |
| Molecular Weight |
56kDa |
| Conjugation |
HRP: Horseradish Peroxidase |
| NCBI Gene Id |
11317 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
recombination signal binding protein for immunoglobulin kappa J region-like |
| Alias Symbols |
RBPL, SUHL, RBPSUHL |
| Peptide Sequence |
Synthetic peptide located within the following region: DPAGAADPSVPPNPLTHLSLQDRSEMQLQSEADRRSLPGTWTRSSPEHTT |
| Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Description of Target |
RBPJL is similar in sequence to the mouse RPB-L protein and Drosophila suppressor of hairless protein. In mouse, recombining binding protein L (RBP-L) is a transcription factor that binds to DNA sequences almost identical to that bound by the Notch receptor signalling pathway transcription factor RBP-J. However, unlike RBP-J, RBP-L does not interact with Notch receptors. RBP-L has been shown to activate transcription in concert with Epstein-Barr virus nuclear antigen-2 (EBNA2). RBPJL is similar in sequence to the mouse RPB-L protein and Drosophila suppressor of hairless protein. |
| Protein Interactions |
APP; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-RBPJL (ARP39071_P050-HRP) antibody |
| Blocking Peptide |
For anti-RBPJL (ARP39071_P050-HRP) antibody is Catalog # AAP39071 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RBPJL |
| Uniprot ID |
Q9UBG7-2 |
| Protein Name |
Recombining binding protein suppressor of hairless-like protein |
| Purification |
Affinity Purified |
| Gene Symbol |
RBPJL |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | |
|
