Search Antibody, Protein, and ELISA Kit Solutions

RBPJL Antibody - N-terminal region : HRP (ARP39071_P050-HRP)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39071_P050 Unconjugated

ARP39071_P050-FITC Conjugated

ARP39071_P050-Biotin Conjugated

Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
HRP
Application:
WB
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Gene Symbol:
RBPJL
Official Gene Full Name:
recombination signal binding protein for immunoglobulin kappa J region-like
NCBI Gene Id:
11317
Protein Name:
Recombining binding protein suppressor of hairless-like protein
Swissprot Id:
Q9UBG7-2
Replacement Item:
This antibody may replace item sc-152762 from Santa Cruz Biotechnology.
Description of Target:
RBPJL is similar in sequence to the mouse RPB-L protein and Drosophila suppressor of hairless protein. In mouse, recombining binding protein L (RBP-L) is a transcription factor that binds to DNA sequences almost identical to that bound by the Notch receptor signalling pathway transcription factor RBP-J. However, unlike RBP-J, RBP-L does not interact with Notch receptors. RBP-L has been shown to activate transcription in concert with Epstein-Barr virus nuclear antigen-2 (EBNA2). RBPJL is similar in sequence to the mouse RPB-L protein and Drosophila suppressor of hairless protein.
Protein Size (# AA):
516
Molecular Weight:
56kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RBPJL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RBPJL.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RBPJL
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-RBPJL (ARP39071_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DPAGAADPSVPPNPLTHLSLQDRSEMQLQSEADRRSLPGTWTRSSPEHTT
Concentration:
0.5 mg/ml
Protein Interactions:
APP;
Blocking Peptide:
For anti-RBPJL (ARP39071_P050-HRP) antibody is Catalog # AAP39071
Datasheets/Manuals:
Printable datasheet for anti-RBPJL (ARP39071_P050-HRP) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...