Size:100 ul
$289.00
In Stock
SKU
ARP39071_P050-HRP
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP39071_P050 Unconjugated

ARP39071_P050-FITC Conjugated

ARP39071_P050-Biotin Conjugated

RBPJL Antibody - N-terminal region : HRP (ARP39071_P050-HRP)

Catalog#: ARP39071_P050-HRP
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement ItemThis antibody may replace item sc-152762 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human RBPJL
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Complete computational species homology dataAnti-RBPJL (ARP39071_P050)
Peptide SequenceSynthetic peptide located within the following region: DPAGAADPSVPPNPLTHLSLQDRSEMQLQSEADRRSLPGTWTRSSPEHTT
Concentration0.5 mg/ml
Blocking PeptideFor anti-RBPJL (ARP39071_P050-HRP) antibody is Catalog # AAP39071
Datasheets/ManualsPrintable datasheet for anti-RBPJL (ARP39071_P050-HRP) antibody
Gene SymbolRBPJL
Official Gene Full Namerecombination signal binding protein for immunoglobulin kappa J region-like
NCBI Gene Id11317
Protein NameRecombining binding protein suppressor of hairless-like protein
Description of TargetRBPJL is similar in sequence to the mouse RPB-L protein and Drosophila suppressor of hairless protein. In mouse, recombining binding protein L (RBP-L) is a transcription factor that binds to DNA sequences almost identical to that bound by the Notch receptor signalling pathway transcription factor RBP-J. However, unlike RBP-J, RBP-L does not interact with Notch receptors. RBP-L has been shown to activate transcription in concert with Epstein-Barr virus nuclear antigen-2 (EBNA2). RBPJL is similar in sequence to the mouse RPB-L protein and Drosophila suppressor of hairless protein.
Swissprot IdQ9UBG7-2
Protein Size (# AA)516
Molecular Weight56kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express RBPJL.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express RBPJL.
Protein InteractionsAPP;
Write Your Own Review
You're reviewing:RBPJL Antibody - N-terminal region : HRP (ARP39071_P050-HRP)
Your Rating
Aviva Travel Grant
Free Microscope
Aviva Live Chat
Aviva Validation Data