| Product Number |
ARP38146_P050-FITC |
| Product Page |
www.avivasysbio.com/maz-antibody-n-terminal-region-fitc-arp38146-p050-fitc.html |
| Name |
MAZ Antibody - N-terminal region : FITC (ARP38146_P050-FITC) |
| Protein Size (# AA) |
477 amino acids |
| Molecular Weight |
48kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
4150 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
MYC-associated zinc finger protein (purine-binding transcription factor) |
| Alias Symbols |
PUR1, ZF87, Pur-1, SAF-1, SAF-2, SAF-3, Zif87, ZNF801 |
| Peptide Sequence |
Synthetic peptide located within the following region: FPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Ray,B.K., (2007) J. Immunol. 178 (3), 1774-1782 |
| Description of Target |
MAZ may function as a transcription factor with dual roles in transcription initiation and termination.It binds to two sites, ME1a1 and ME1a2, within the c-myc promoter having greater affinity for the former. It also binds to multiple G/C-rich sites within the promoter of the Sp1 family of transcription factors. |
| Protein Interactions |
HECW2; MAPK14; BPTF; JUN; FOS; KEAP1; DCC; CSNK2A1; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-MAZ (ARP38146_P050-FITC) antibody |
| Blocking Peptide |
For anti-MAZ (ARP38146_P050-FITC) antibody is Catalog # AAP38146 (Previous Catalog # AAPP10733) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MAZ |
| Uniprot ID |
P56270 |
| Protein Name |
Myc-associated zinc finger protein |
| Publications |
Smits, M. et al. Myc-associated zinc finger protein (MAZ) is regulated by miR-125b and mediates VEGF-induced angiogenesis in glioblastoma. FASEB J. 26, 2639-47 (2012). WB, IHC, ELISA, Rat, Mouse, Human, Pig 22415301 |
| Sample Type Confirmation |
MAZ is strongly supported by BioGPS gene expression data to be expressed in HEK293T |
| Protein Accession # |
NP_002374 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_002383 |
| Gene Symbol |
MAZ |
| Predicted Species Reactivity |
Human, Mouse, Rat, Pig |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100% |
| Image 1 | |
