Search Antibody, Protein, and ELISA Kit Solutions

MAZ Antibody - N-terminal region : FITC (ARP38146_P050-FITC)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38146_P050 Unconjugated

ARP38146_P050-HRP Conjugated

ARP38146_P050-Biotin Conjugated

Gene Symbol:
MAZ
Official Gene Full Name:
MYC-associated zinc finger protein (purine-binding transcription factor)
NCBI Gene Id:
4150
Protein Name:
Myc-associated zinc finger protein
Swissprot Id:
P56270
Protein Accession #:
NP_002374
Nucleotide Accession #:
NM_002383
Alias Symbols:
PUR1, Pur-1, SAF-1, SAF-2, ZF87, ZNF801, Zif87, SAF-3
Replacement Item:
This antibody may replace item sc-130915 from Santa Cruz Biotechnology.
Description of Target:
MAZ may function as a transcription factor with dual roles in transcription initiation and termination.It binds to two sites, ME1a1 and ME1a2, within the c-myc promoter having greater affinity for the former. It also binds to multiple G/C-rich sites within the promoter of the Sp1 family of transcription factors.
Protein Size (# AA):
477
Molecular Weight:
48kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MAZ.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MAZ.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human MAZ
Predicted Species Reactivity:
Human, Mouse, Pig, Rat
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Complete computational species homology data:
Anti-MAZ (ARP38146_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
HECW2; MAPK14; BPTF; JUN; FOS; KEAP1; DCC; CSNK2A1;
Blocking Peptide:
For anti-MAZ (ARP38146_P050-FITC) antibody is Catalog # AAP38146 (Previous Catalog # AAPP10733)
Datasheets/Manuals:
Printable datasheet for anti-MAZ (ARP38146_P050-FITC) antibody
Sample Type Confirmation:

MAZ is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Ray,B.K., (2007) J. Immunol. 178 (3), 1774-1782
Publications:

Smits, M. et al. Myc-associated zinc finger protein (MAZ) is regulated by miR-125b and mediates VEGF-induced angiogenesis in glioblastoma. FASEB J. 26, 2639-47 (2012). WB, IHC, ELISA, Rat, Mouse, Human, Pig 22415301

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...