Ighmbp2 Antibody - N-terminal region (ARP38126_P050)

• Product Number: ARP38126_P050
• Name: Ighmbp2 Antibody - N-terminal region (ARP38126_P050)
• Protein Size (# AA): 993 amino acids
• Molecular Weight: 109 kDa
• NCBI Gene Id: 20589
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Immunoglobulin mu binding protein 2
• Alias Symbols: A, s, AEP, Smb, nmd, sma, Catf, RIPE, Smbp, Smub, Catf1, Smbp2, Smbp-2, Smubp2, RIPE3b1
• Peptide Sequence: Synthetic peptide located within the following region: QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Ighmbp2 is a 5' to 3' helicase that unwinds RNA and DNA duplices in an ATP-dependent reaction. Ighmbp2 acts as a transcription regulator. Ighmbp2 is required for the transcriptional activation of the flounder liver-type antifreeze protein gene. Ighmbp2 exhibits strong binding specificity to the enhancer element B of the flounder antifreeze protein gene intron. Ighmbp2 binds to the insulin II gene RIPE3B enhancer region. Ighmbp2 may be involved in translation.Ighmbp2 is a DNA-binding protein specific to 5'-phosphorylated single-stranded guanine-rich sequence related to the immunoglobulin mu chain switch region.Ighmbp2 preferentially binds to the 5'-GGGCT-3' motif. Ighmbp2 interacts with tRNA-Tyr.
• Protein Interactions: Gtf3c1; Hnrnph1; Ruvbl1; Abt1; Zbtb14; Tyr; Ighmbp2; Ruvbl2; Hspa1b; Slit3; Robo1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-Ighmbp2 (ARP38126_P050) antibody is Catalog # AAP38126 (Previous Catalog # AAPP20303)
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Uniprot ID: P40694
• Protein Name: DNA-binding protein SMUBP-2
• Publications:

  Rescue of a Mouse Model of Spinal Muscular Atrophy With Respiratory Distress Type 1 by AAV9-IGHMBP2 Is Dose Dependent. Mol. Ther. 24, 855-66 (2016). 26860981

• Protein Accession #: NP_033238
• Purification: Affinity Purified
• Nucleotide Accession #: NM_009212
• Tested Species Reactivity: Mouse
• Gene Symbol: Ighmbp2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%