- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-Ighmbp2 (ARP38126_P050) antibody |
---|
Tested Species Reactivity | Mouse | ||||||
---|---|---|---|---|---|---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig | ||||||
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||||||
Clonality | Polyclonal | ||||||
Host | Rabbit | ||||||
Application | WB | ||||||
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||||||
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse | ||||||
Purification | Affinity Purified | ||||||
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100% | ||||||
Peptide Sequence | Synthetic peptide located within the following region: QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL | ||||||
Concentration | 0.5 mg/ml | ||||||
Blocking Peptide | For anti-Ighmbp2 (ARP38126_P050) antibody is Catalog # AAP38126 (Previous Catalog # AAPP20303) | ||||||
Enhanced Validation |
| ||||||
Publications | Rescue of a Mouse Model of Spinal Muscular Atrophy With Respiratory Distress Type 1 by AAV9-IGHMBP2 Is Dose Dependent. Mol. Ther. 24, 855-66 (2016). 26860981 |
Gene Symbol | Ighmbp2 |
---|---|
Gene Full Name | Immunoglobulin mu binding protein 2 |
Alias Symbols | A, s, AEP, Smb, nmd, sma, Catf, RIPE, Smbp, Smub, Catf1, Smbp2, Smbp-2, Smubp2, RIPE3b1 |
NCBI Gene Id | 20589 |
Protein Name | DNA-binding protein SMUBP-2 |
Description of Target | Ighmbp2 is a 5' to 3' helicase that unwinds RNA and DNA duplices in an ATP-dependent reaction. Ighmbp2 acts as a transcription regulator. Ighmbp2 is required for the transcriptional activation of the flounder liver-type antifreeze protein gene. Ighmbp2 exhibits strong binding specificity to the enhancer element B of the flounder antifreeze protein gene intron. Ighmbp2 binds to the insulin II gene RIPE3B enhancer region. Ighmbp2 may be involved in translation.Ighmbp2 is a DNA-binding protein specific to 5'-phosphorylated single-stranded guanine-rich sequence related to the immunoglobulin mu chain switch region.Ighmbp2 preferentially binds to the 5'-GGGCT-3' motif. Ighmbp2 interacts with tRNA-Tyr. |
Uniprot ID | P40694 |
Protein Accession # | NP_033238 |
Nucleotide Accession # | NM_009212 |
Protein Size (# AA) | 993 |
Molecular Weight | 109 kDa |
Protein Interactions | Gtf3c1; Hnrnph1; Ruvbl1; Abt1; Zbtb14; Tyr; Ighmbp2; Ruvbl2; Hspa1b; Slit3; Robo1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "Ighmbp2 Antibody - N-terminal region (ARP38126_P050)"?
The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig".
-
How long will it take to receive "Ighmbp2 Antibody - N-terminal region (ARP38126_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "Ighmbp2 Antibody - N-terminal region (ARP38126_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "Ighmbp2 Antibody - N-terminal region (ARP38126_P050)"?
This target may also be called "A, s, AEP, Smb, nmd, sma, Catf, RIPE, Smbp, Smub, Catf1, Smbp2, Smbp-2, Smubp2, RIPE3b1" in publications.
-
What is the shipping cost for "Ighmbp2 Antibody - N-terminal region (ARP38126_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "Ighmbp2 Antibody - N-terminal region (ARP38126_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "Ighmbp2 Antibody - N-terminal region (ARP38126_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "109 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "Ighmbp2 Antibody - N-terminal region (ARP38126_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "IGHMBP2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "IGHMBP2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "IGHMBP2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "IGHMBP2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "IGHMBP2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "IGHMBP2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.