Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP38126_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38126_P050-FITC Conjugated

ARP38126_P050-HRP Conjugated

ARP38126_P050-Biotin Conjugated

Ighmbp2 Antibody - N-terminal region (ARP38126_P050)

Catalog#: ARP38126_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-168143 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data Anti-Ighmbp2 (ARP38126_P050)
Peptide Sequence Synthetic peptide located within the following region: QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Ighmbp2 (ARP38126_P050) antibody is Catalog # AAP38126 (Previous Catalog # AAPP20303)
Datasheets/Manuals Printable datasheet for anti-Ighmbp2 (ARP38126_P050) antibody
Publications

Shababi, M; Feng, Z; Villalon, E; Sibigtroth, CM; Osman, EY; Miller, MR; Williams-Simon, PA; Lombardi, A; Sass, TH; Atkinson, AK; Garcia, ML; Ko, CP; Lorson, CL; Rescue of a Mouse Model of Spinal Muscular Atrophy With Respiratory Distress Type 1 by AAV9-IGHMBP2 Is Dose Dependent. 24, 855-66 (2016). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rat 26860981

Gene Symbol Ighmbp2
Official Gene Full Name Immunoglobulin mu binding protein 2
Alias Symbols AEP, Catf1, RIPE3b1, Smbp-2, Smbp2, Smubp2, nmd, sma
NCBI Gene Id 20589
Protein Name DNA-binding protein SMUBP-2
Description of Target Ighmbp2 is a 5' to 3' helicase that unwinds RNA and DNA duplices in an ATP-dependent reaction. Ighmbp2 acts as a transcription regulator. Ighmbp2 is required for the transcriptional activation of the flounder liver-type antifreeze protein gene. Ighmbp2 exhibits strong binding specificity to the enhancer element B of the flounder antifreeze protein gene intron. Ighmbp2 binds to the insulin II gene RIPE3B enhancer region. Ighmbp2 may be involved in translation.Ighmbp2 is a DNA-binding protein specific to 5'-phosphorylated single-stranded guanine-rich sequence related to the immunoglobulin mu chain switch region.Ighmbp2 preferentially binds to the 5'-GGGCT-3' motif. Ighmbp2 interacts with tRNA-Tyr.
Swissprot Id P40694
Protein Accession # NP_033238
Nucleotide Accession # NM_009212
Protein Size (# AA) 993
Molecular Weight 109kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Ighmbp2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Ighmbp2.
Protein Interactions Gtf3c1; Hnrnph1; Ruvbl1; Abt1; Zbtb14; Tyr; Ighmbp2; Ruvbl2; Hspa1b; Slit3; Robo1;
  1. What is the species homology for "Ighmbp2 Antibody - N-terminal region (ARP38126_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Human, Mouse, Rat".

  2. How long will it take to receive "Ighmbp2 Antibody - N-terminal region (ARP38126_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Ighmbp2 Antibody - N-terminal region (ARP38126_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Ighmbp2 Antibody - N-terminal region (ARP38126_P050)"?

    This target may also be called "AEP, Catf1, RIPE3b1, Smbp-2, Smbp2, Smubp2, nmd, sma" in publications.

  5. What is the shipping cost for "Ighmbp2 Antibody - N-terminal region (ARP38126_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Ighmbp2 Antibody - N-terminal region (ARP38126_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Ighmbp2 Antibody - N-terminal region (ARP38126_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "109kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Ighmbp2 Antibody - N-terminal region (ARP38126_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "IGHMBP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IGHMBP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IGHMBP2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IGHMBP2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IGHMBP2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IGHMBP2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Ighmbp2 Antibody - N-terminal region (ARP38126_P050)
Your Rating