Search Antibody, Protein, and ELISA Kit Solutions

Ighmbp2 antibody - N-terminal region (ARP38126_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38126_P050-FITC Conjugated

ARP38126_P050-HRP Conjugated

ARP38126_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Immunoglobulin mu binding protein 2
Protein Name:
DNA-binding protein SMUBP-2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
AEP, Catf1, RIPE3b1, Smbp-2, Smbp2, Smubp2, nmd, sma
Replacement Item:
This antibody may replace item sc-168143 from Santa Cruz Biotechnology.
Description of Target:
Ighmbp2 is a 5' to 3' helicase that unwinds RNA and DNA duplices in an ATP-dependent reaction. Ighmbp2 acts as a transcription regulator. Ighmbp2 is required for the transcriptional activation of the flounder liver-type antifreeze protein gene. Ighmbp2 exhibits strong binding specificity to the enhancer element B of the flounder antifreeze protein gene intron. Ighmbp2 binds to the insulin II gene RIPE3B enhancer region. Ighmbp2 may be involved in translation.Ighmbp2 is a DNA-binding protein specific to 5'-phosphorylated single-stranded guanine-rich sequence related to the immunoglobulin mu chain switch region.Ighmbp2 preferentially binds to the 5'-GGGCT-3' motif. Ighmbp2 interacts with tRNA-Tyr.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Ighmbp2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Ighmbp2.
The immunogen is a synthetic peptide corresponding to a region of Mouse
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-Ighmbp2 (ARP38126_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Gtf3c1; Hnrnph1; Ruvbl1; Abt1; Zbtb14; Tyr; Ighmbp2; Ruvbl2; Hspa1b; Slit3; Robo1;
Blocking Peptide:
For anti-Ighmbp2 (ARP38126_P050) antibody is Catalog # AAP38126 (Previous Catalog # AAPP20303)
Printable datasheet for anti-Ighmbp2 (ARP38126_P050) antibody

Shababi, M; Feng, Z; Villalon, E; Sibigtroth, CM; Osman, EY; Miller, MR; Williams-Simon, PA; Lombardi, A; Sass, TH; Atkinson, AK; Garcia, ML; Ko, CP; Lorson, CL; Rescue of a Mouse Model of Spinal Muscular Atrophy With Respiratory Distress Type 1 by AAV9-IGHMBP2 Is Dose Dependent. 24, 855-66 (2016). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rat 26860981

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...