| Product Number |
ARP38027_P050 |
| Product Page |
www.avivasysbio.com/csrp2-antibody-c-terminal-region-arp38027-p050.html |
| Name |
CSRP2 Antibody - C-terminal region (ARP38027_P050) |
| Protein Size (# AA) |
193 amino acids |
| Molecular Weight |
21kDa |
| NCBI Gene Id |
1466 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cysteine and glycine-rich protein 2 |
| Alias Symbols |
CRP2, LMO5, SmLIM |
| Peptide Sequence |
Synthetic peptide located within the following region: FRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Stearns,M.E., (2003) Mol. Cancer Res. 1 (9), 631-642 |
| Description of Target |
CSRP2 is a member of the CSRP family. CSRP family is a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth. Other genes in the family include CSRP1 and CSRP3.CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth. Other genes in the family include CSRP1 and CSRP3. |
| Protein Interactions |
TRIM27; RNF2; BMI1; UBC; MDC1; AGPS; CSRP2BP; PIAS1; EEF1A1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CSRP2 (ARP38027_P050) antibody |
| Blocking Peptide |
For anti-CSRP2 (ARP38027_P050) antibody is Catalog # AAP38027 (Previous Catalog # AAPP10063) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CSRP2 |
| Uniprot ID |
Q16527 |
| Protein Name |
Cysteine and glycine-rich protein 2 |
| Protein Accession # |
NP_001312 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001321 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CSRP2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Human HepG2
 | WB Suggested Anti-CSRP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate |
|
|
