Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

CSRP2 Antibody - C-terminal region (ARP38027_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38027_P050-FITC Conjugated

ARP38027_P050-HRP Conjugated

ARP38027_P050-Biotin Conjugated

Gene Symbol:
CSRP2
Official Gene Full Name:
Cysteine and glycine-rich protein 2
NCBI Gene Id:
1466
Protein Name:
Cysteine and glycine-rich protein 2
Swissprot Id:
Q16527
Protein Accession #:
NP_001312
Nucleotide Accession #:
NM_001321
Alias Symbols:
CRP2, LMO5, SmLIM
Replacement Item:
This antibody may replace item sc-167547 from Santa Cruz Biotechnology.
Description of Target:
CSRP2 is a member of the CSRP family. CSRP family is a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth. Other genes in the family include CSRP1 and CSRP3.CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth. Other genes in the family include CSRP1 and CSRP3.
Protein Size (# AA):
193
Molecular Weight:
21kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CSRP2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CSRP2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human CSRP2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-CSRP2 (ARP38027_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
TRIM27; RNF2; BMI1; UBC; MDC1; AGPS; CSRP2BP; PIAS1; EEF1A1;
Blocking Peptide:
For anti-CSRP2 (ARP38027_P050) antibody is Catalog # AAP38027 (Previous Catalog # AAPP10063)
Datasheets/Manuals:
Printable datasheet for anti-CSRP2 (ARP38027_P050) antibody
Target Reference:
Stearns,M.E., (2003) Mol. Cancer Res. 1 (9), 631-642

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...