WT1 Antibody - N-terminal region (ARP37988_P050)
Data Sheet
 
Product Number ARP37988_P050
Product Page www.avivasysbio.com/wt1-antibody-n-terminal-region-arp37988-p050.html
Product Name WT1 Antibody - N-terminal region (ARP37988_P050)
Size 100 ul
Gene Symbol WT1
Alias Symbols AWT1, GUD, WAGR, WIT-2, WT33, NPHS4, EWS-WT1
Protein Size (# AA) 497 amino acids
Molecular Weight 54kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 7490
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Wilms tumor 1
Peptide Sequence Synthetic peptide located within the following region: PASQHTLRSGPGCLQQPEQQGVRDPGGIWAKLGAAEASAERLQGRRSRGA
Description of Target WT1 is a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system, and it is mutated in a small subset of patients with Wilm's tumors. Multiple transcript variants, resulting from alternative splicing at two coding exons, have been well characterized. There is also evidence for the use of non-AUG (CUG) translation initiation site upstream of, and in-frame with the first AUG, leading to additional isoforms.
Protein Interactions KRTAP10-3; KRTAP10-8; KRT40; EGR1; MDM2; DVL3; CIAO1; TP53; HSPA4; TAOK1; NPM3; ZNF205; SUZ12; MEN1; EZH2; DNMT1; WTIP; WTAP; PAWR; UBE2I; TP63; FHL2; TP73; PRKACA; CREBBP; U2AF2; PAX2; AREG;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-WT1 (ARP37988_P050) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-WT1 (ARP37988_P050) antibody is Catalog # AAP37988 (Previous Catalog # AAPP20090)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human WT1
Complete computational species homology data Anti-WT1 (ARP37988_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express WT1.
Swissprot Id E9PMK7
Protein Accession # NP_000369
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express WT1.
Nucleotide Accession # NM_000378
Replacement Item This antibody may replace item sc-15421 from Santa Cruz Biotechnology.
Tested Species Reactivity Human
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human HeLa
WB Suggested Anti-WT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com