ZBTB7A Antibody - N-terminal region (ARP35900_P050)

• Product Number: ARP35900_P050
• Name: ZBTB7A Antibody - N-terminal region (ARP35900_P050)
• Protein Size (# AA): 584 amino acids
• Molecular Weight: 64kDa
• NCBI Gene Id: 51341
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: zinc finger and BTB domain containing 7A
• Alias Symbols: LRF, FBI1, FBI-1, TIP21, ZBTB7, ZNF857A, pokemon
• Peptide Sequence: Synthetic peptide located within the following region: MNSLPPAAAAAAASFPWSAFGASDDDLDATKEAVAAAVAAVAAGDCNGLD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The function of Anti-ZBTB7A has not yet been determined.
• Protein Interactions: HOMEZ; SOX9; ZBTB48; SOX2; ZMYND8; UTP20; RELA; NFKBIB; NFKBIA; tat; SUMO1; TFAP4; SREBF1; EEF1A1; Cebpb; NCOR2; NCOR1; AR; SUMO2; SP1; BCOR; RB1; ZBTB7A; SIN3A; SIRT1; HDAC3; TP53; HDAC2; HDAC1; SP3; SP4; BCL6;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZBTB7A (ARP35900_P050) antibody is Catalog # AAP35900
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZBTB7A
• Uniprot ID: O95365
• Protein Name: Zinc finger and BTB domain-containing protein 7A
• Protein Accession #: NP_056982
• Purification: Affinity Purified
• Nucleotide Accession #: NM_015898
• Tested Species Reactivity: Human
• Gene Symbol: ZBTB7A
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 86%; Rat: 83%
• Image 1: Human Liver Tumor
  
  Host: Rabbit
  Target Name: ZBTB7A
  Sample Type: Liver Tumor lysates
  Antibody Dilution: 1.0ug/ml