Search Antibody, Protein, and ELISA Kit Solutions

ZBTB7A Antibody - N-terminal region (ARP35900_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35900_P050-FITC Conjugated

ARP35900_P050-HRP Conjugated

ARP35900_P050-Biotin Conjugated

Gene Symbol:
ZBTB7A
Official Gene Full Name:
zinc finger and BTB domain containing 7A
NCBI Gene Id:
51341
Protein Name:
Zinc finger and BTB domain-containing protein 7A
Swissprot Id:
O95365
Protein Accession #:
NP_056982
Nucleotide Accession #:
NM_015898
Alias Symbols:
FBI-1, FBI1, LRF, ZBTB7, ZNF857A, pokemon
Replacement Item:
This antibody may replace item sc-33683 from Santa Cruz Biotechnology.
Description of Target:
The function of Anti-ZBTB7A has not yet been determined.
Protein Size (# AA):
584
Molecular Weight:
64kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZBTB7A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZBTB7A.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZBTB7A
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 86%; Rat: 83%
Complete computational species homology data:
Anti-ZBTB7A (ARP35900_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MNSLPPAAAAAAASFPWSAFGASDDDLDATKEAVAAAVAAVAAGDCNGLD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HOMEZ; SOX9; ZBTB48; SOX2; ZMYND8; UTP20; RELA; NFKBIB; NFKBIA; tat; SUMO1; TFAP4; SREBF1; EEF1A1; Cebpb; NCOR2; NCOR1; AR; SUMO2; SP1; BCOR; RB1; ZBTB7A; SIN3A; SIRT1; HDAC3; TP53; HDAC2; HDAC1; SP3; SP4; BCL6;
Blocking Peptide:
For anti-ZBTB7A (ARP35900_P050) antibody is Catalog # AAP35900
Datasheets/Manuals:
Printable datasheet for anti-ZBTB7A (ARP35900_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...