Product Number |
ARP35820_P050 |
Product Page |
www.avivasysbio.com/znf197-antibody-n-terminal-region-arp35820-p050.html |
Name |
ZNF197 Antibody - N-terminal region (ARP35820_P050) |
Protein Size (# AA) |
267 amino acids |
Molecular Weight |
30kDa |
NCBI Gene Id |
10168 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 197 |
Alias Symbols |
P18, VHLaK, ZNF20, ZNF166, ZKSCAN9, ZSCAN41, D3S1363E |
Peptide Sequence |
Synthetic peptide located within the following region: MTRENVAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHLHFRQLRY |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Li,Z., (2003) EMBO J. 22 (8), 1857-1867 |
Description of Target |
ZNF197 belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. This gene product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. This gene is located in a cluster of zinc finger genes at 3p21. Two alternatively spliced transcripts encoding different isoforms have been described. |
Protein Interactions |
UBC; NDEL1; DISC1; ZNF197; TRIM28; VHL; HIF1A; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF197 (ARP35820_P050) antibody |
Blocking Peptide |
For anti-ZNF197 (ARP35820_P050) antibody is Catalog # AAP35820 (Previous Catalog # AAPP07072) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF197 |
Uniprot ID |
Q86VG0 |
Protein Name |
Zinc finger protein 197 |
Protein Accession # |
NP_001020026 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001024855 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF197 |
Predicted Species Reactivity |
Human, Rat, Cow, Dog, Horse, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 92%; Horse: 100%; Human: 100%; Pig: 100%; Rat: 92% |
Image 1 | Human Heart
| WB Suggested Anti-ZNF197 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human heart |
|
|