Search Antibody, Protein, and ELISA Kit Solutions

ZNF197 Antibody - N-terminal region (ARP35820_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP35820_P050-FITC Conjugated

ARP35820_P050-HRP Conjugated

ARP35820_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Pig, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Zinc finger protein 197
NCBI Gene Id:
Protein Name:
Zinc finger protein 197
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
D3S1363E, P18, VHLaK, ZKSCAN9, ZNF166, ZNF20
Description of Target:
ZNF197 belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. This gene product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. This gene is located in a cluster of zinc finger genes at 3p21. Two alternatively spliced transcripts encoding different isoforms have been described.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZNF197.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZNF197.
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF197
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 92%; Horse: 100%; Human: 100%; Pig: 100%; Rat: 92%
Complete computational species homology data:
Anti-ZNF197 (ARP35820_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MTRENVAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHLHFRQLRY
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ZNF197 (ARP35820_P050) antibody is Catalog # AAP35820 (Previous Catalog # AAPP07072)
Printable datasheet for anti-ZNF197 (ARP35820_P050) antibody
Target Reference:
Li,Z., (2003) EMBO J. 22 (8), 1857-1867

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...