| Product Number |
ARP34851_P050 |
| Product Page |
www.avivasysbio.com/znf576-antibody-middle-region-arp34851-p050.html |
| Name |
ZNF576 Antibody - middle region (ARP34851_P050) |
| Protein Size (# AA) |
170 amino acids |
| Molecular Weight |
18kDa |
| NCBI Gene Id |
79177 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
zinc finger protein 576 |
| Peptide Sequence |
Synthetic peptide located within the following region: TCARSFPSSKALITHQRSHGPAAKPTLPVATTTAQPTFPCPDCGKTFGQA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Protein Interactions |
SH3GLB1; AP4B1; KRT15; AES; MAPKAPK5; SUOX; RARG; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF576 (ARP34851_P050) antibody |
| Blocking Peptide |
For anti-ZNF576 (ARP34851_P050) antibody is Catalog # AAP34851 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human ZN576 |
| Uniprot ID |
Q9H609 |
| Protein Name |
zinc finger protein 576 |
| Protein Accession # |
NP_077303 |
| Purification |
Affinity Purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF576 |
| Predicted Species Reactivity |
Human, Rat, Cow, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Horse: 100%; Human: 100%; Pig: 92%; Rabbit: 92%; Rat: 90% |
| Image 1 | Human Fetal Liver
 | Host: Rabbit
Target Name: ZN576
Sample Type: Fetal Liver lysates
Antibody Dilution: 1ug/ml |
|
|
