Search Antibody, Protein, and ELISA Kit Solutions

ZNF576 Antibody - middle region (ARP34851_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34851_P050-FITC Conjugated

ARP34851_P050-HRP Conjugated

ARP34851_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
zinc finger protein 576
Protein Name:
zinc finger protein 576
Swissprot Id:
Protein Accession #:
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZNF576.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZNF576.
The immunogen is a synthetic peptide directed towards the middle region of Human ZN576
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Horse: 100%; Human: 100%; Pig: 92%; Rabbit: 92%; Rat: 90%
Complete computational species homology data:
Anti-ZNF576 (ARP34851_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TCARSFPSSKALITHQRSHGPAAKPTLPVATTTAQPTFPCPDCGKTFGQA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ZNF576 (ARP34851_P050) antibody is Catalog # AAP34851
Printable datasheet for anti-ZNF576 (ARP34851_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...