CREB3L2 Antibody - N-terminal region : FITC (ARP34673_T100-FITC)

• Product Number: ARP34673_T100-FITC
• Name: CREB3L2 Antibody - N-terminal region : FITC (ARP34673_T100-FITC)
• Protein Size (# AA): 520 amino acids
• Molecular Weight: 57kDa
• Conjugation: FITC: Fluorescein Isothiocyanate
• NCBI Gene Id: 64764
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: CAMP responsive element binding protein 3-like 2
• Alias Symbols: BBF2H7
• Peptide Sequence: Synthetic peptide located within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Reference: Storlazzi,C.T., et al., (2003) Hum. Mol. Genet. 12 (18), 2349-2358
• Description of Target: CREB3L2 is a member of the old astrocyte specifically induced substance (OASIS) DNA binding and basic leucine zipper dimerization (bZIP) family of transcription factors, which includes CREB3 (MIM 606443) and CREB4 (MIM 607138).
• Protein Interactions: Fbxw7; UBE2D3; UBA1; GAS7; UBC; GCFC2; RGS16; PXN; CEP19; GULP1; RND1; ZNF212; PTP4A1; ELAVL1; SUMO2; Dynll1;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-CREB3L2 (ARP34673_T100-FITC) antibody is Catalog # AAP34673 (Previous Catalog # AAPP05863)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CREB3L2
• Uniprot ID: Q70SY1
• Protein Name: Cyclic AMP-responsive element-binding protein 3-like protein 2
• Publications:

  Sievert, A. J. et al. Duplication of 7q34 in pediatric low-grade astrocytomas detected by high-density single-nucleotide polymorphism-based genotype arrays results in a novel BRAF fusion gene. Brain Pathol. 19, 449-58 (2009). WB, Human, Bovine, Horse, Rabbit, Rat, Guinea pig, Mouse, Dog 19016743

  Fox, R. M., Hanlon, C. D. & Andrew, D. J. The CrebA/Creb3-like transcription factors are major and direct regulators of secretory capacity. J. Cell Biol. 191, 479-92 (2010). ICC/IF, Human, Bovine, Horse, Rabbit, Rat, Guinea pig, Mouse, Dog 21041443

  Lynch, J. M. et al. A thrombospondin-dependent pathway for a protective ER stress response. Cell 149, 1257-68 (2012). WB, Human, Bovine, Horse, Rabbit, Rat, Guinea pig, Mouse, Dog 22682248

• Protein Accession #: NP_919047
• Nucleotide Accession #: NM_194071
• Gene Symbol: CREB3L2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 85%; Guinea Pig: 87%; Horse: 87%; Human: 100%; Mouse: 86%; Rabbit: 87%; Rat: 87%
• Image 1: