CRIP2 Antibody - middle region (ARP34373_P050)

Data Sheet
 
Product Number ARP34373_P050
Product Page www.avivasysbio.com/crip2-antibody-middle-region-arp34373-p050.html
Name CRIP2 Antibody - middle region (ARP34373_P050)
Protein Size (# AA) 208 amino acids
Molecular Weight 22kDa
NCBI Gene Id 1397
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cysteine-rich protein 2
Alias Symbols CRIP, CRP2, ESP1
Peptide Sequence Synthetic peptide located within the following region: TLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lim,J., (2006) Cell 125 (4), 801-814
Description of Target The exact function of CRIP2 remains unknown.
Protein Interactions BAG3; ATXN1; APP; ATN1; OSGEP; GADD45G; SPRY2; TK1; KLF10; SMN1; PCYT2; ATP1B1; GATA6; GATA4; PRKG1; SRF; PTPN13;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CRIP2 (ARP34373_P050) antibody
Blocking Peptide For anti-CRIP2 (ARP34373_P050) antibody is Catalog # AAP34373 (Previous Catalog # AAPP23684)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CRIP2
Uniprot ID P52943
Protein Name Cysteine-rich protein 2
Sample Type Confirmation

CRIP2 is supported by BioGPS gene expression data to be expressed in MCF7

Protein Accession # NP_001303
Purification Affinity Purified
Nucleotide Accession # NM_001312
Tested Species Reactivity Human
Gene Symbol CRIP2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 79%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human Lung Tissue
Rabbit Anti-CRIP2 Antibody
Catalog Number: ARP34373_P050
Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
Observed Staining: Cytoplasmic in alveolar type I cells
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 2
Hela, Human liver
Host: Rabbit
Target: CRIP2
Positive control (+): Hela (HL)
Negative control (-): Human liver (LI)
Antibody concentration: 1ug/ml
Image 3
Human MCF-7
WB Suggested Anti-CRIP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysateCRIP2 is supported by BioGPS gene expression data to be expressed in MCF7
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com