Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CRIP2 antibody - middle region (ARP34373_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP34373_P050-FITC Conjugated

ARP34373_P050-HRP Conjugated

ARP34373_P050-Biotin Conjugated

Gene Symbol:
CRIP2
NCBI Gene Id:
1397
Official Gene Full Name:
Cysteine-rich protein 2
Protein Name:
Cysteine-rich protein 2
Swissprot Id:
P52943
Protein Accession #:
NP_001303
Nucleotide Accession #:
NM_001312
Alias Symbols:
CRIP, CRP2, ESP1
Replacement Item:
This antibody may replace item sc-119461 from Santa Cruz Biotechnology.
Description of Target:
The exact function of CRIP2 remains unknown.
Protein Size (# AA):
208
Molecular Weight:
22kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CRIP2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CRIP2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CRIP2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 79%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-CRIP2 (ARP34373_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
BAG3; ATXN1; APP; ATN1; OSGEP; GADD45G; SPRY2; TK1; KLF10; SMN1; PCYT2; ATP1B1; GATA6; GATA4; PRKG1; SRF; PTPN13;
Blocking Peptide:
For anti-CRIP2 (ARP34373_P050) antibody is Catalog # AAP34373 (Previous Catalog # AAPP23684)
Datasheets/Manuals:
Printable datasheet for anti-CRIP2 (ARP34373_P050) antibody
Sample Type Confirmation:

CRIP2 is supported by BioGPS gene expression data to be expressed in MCF7

Target Reference:
Lim,J., (2006) Cell 125 (4), 801-814

Tell us what you think about this item!

Write A Review
    Please, wait...