| Product Number |
ARP33810_T100 |
| Product Page |
www.avivasysbio.com/a1bg-antibody-n-terminal-region-arp33810-t100.html |
| Name |
A1BG Antibody - N-terminal region (ARP33810_T100) |
| Protein Size (# AA) |
495 amino acids |
| Molecular Weight |
54 kDa |
| NCBI Gene Id |
1 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Alpha-1-B glycoprotein |
| Alias Symbols |
A1B, ABG, GAB, HYST2477 |
| Peptide Sequence |
Synthetic peptide located within the following region: ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Udby,L., (2004) Biochemistry 43 (40), 12877-12886 |
| Description of Target |
A1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins. The protein encoded by this gene is a plasma glycoprotein of unknown function. The protein shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-7 BX325198.2 1-7 8-1722 AB073611.1 1-1715 1723-1766 AK056201.1 462-505 |
| Protein Interactions |
SETD7; PRDX4; ABCC6; TK1; SNCA; SMN1; GRB7; CDKN1A; ANXA7; CRISP3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-A1BG (ARP33810_T100) antibody |
| Blocking Peptide |
For anti-A1BG (ARP33810_T100) antibody is Catalog # AAP33810 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human A1BG |
| Uniprot ID |
P04217 |
| Protein Name |
Alpha-1B-glycoprotein |
| Protein Accession # |
NP_570602 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_130786 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
A1BG |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-A1BG Antibody
Titration: 1.25 ug/ml
Positive Control: HepG2 Whole Cell |
| | Image 2 | Human
 | WB Suggested Anti-A1BG Antibody
Titration: 5 ug/ml
Positive Control: human liver, human serum, human plasma |
| | Image 3 | Western Blot
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/mL of the antibody was used in this experiment. Recommended dilution is 1-3 ug/mL. Protein is processed from 54 kDa to 52 kDa. |
|
|
