| Product Number |
ARP33613_P050 |
| Product Page |
www.avivasysbio.com/cldn7-antibody-middle-region-arp33613-p050.html |
| Name |
CLDN7 Antibody - middle region (ARP33613_P050) |
| Protein Size (# AA) |
211 amino acids |
| Molecular Weight |
22kDa |
| NCBI Gene Id |
1366 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Claudin 7 |
| Alias Symbols |
CLDN-7, CEPTRL2, CPETRL2, Hs.84359, claudin-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kleinberg,L., (2008) Hum. Pathol. 39 (5), 747-757 |
| Description of Target |
Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells.Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells (Zheng et al., 2003 [PubMed 14502431]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
SYNE4; HGD; LNX1; UBC; TJP1; RHOXF2; EPCAM; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CLDN7 (ARP33613_P050) antibody |
| Blocking Peptide |
For anti-CLDN7 (ARP33613_P050) antibody is Catalog # AAP33613 (Previous Catalog # AAPP04669) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CLDN7 |
| Uniprot ID |
O95471 |
| Protein Name |
Claudin-7 |
| Protein Accession # |
NP_001298 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001307 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CLDN7 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep, Yeast |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 79%; Horse: 79%; Human: 100%; Mouse: 93%; Pig: 79%; Rabbit: 86%; Rat: 93%; Sheep: 79%; Yeast: 77% |
| Image 1 | Human Lung
 | WB Suggested Anti-CLDN7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung |
|
|
