Product Number |
ARP32328_P050 |
Product Page |
www.avivasysbio.com/bmp7-antibody-n-terminal-region-arp32328-p050.html |
Name |
Bmp7 Antibody - N-terminal region (ARP32328_P050) |
Protein Size (# AA) |
431 amino acids |
Molecular Weight |
49 kDa |
NCBI Gene Id |
655 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Bone morphogenetic protein 7 |
Alias Symbols |
OP-1 |
Peptide Sequence |
Synthetic peptide located within the following region: MVAFFKATEVHLRSIRSTGGKQRSQNRSKTPKNQEALRMASVAENSSSDQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of Bmp7 remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Bmp7 (ARP32328_P050) antibody |
Additional Information |
IHC Information: Skin IHC Information: Kidney |
Blocking Peptide |
For anti-Bmp7 (ARP32328_P050) antibody is Catalog # AAP32328 (Previous Catalog # AAPP03315) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
Uniprot ID |
P18075 |
Publications |
Kitamura, S. et al. The Selection of Peritoneal Mesothelial Cells Is Important for Cell Therapy to Prevent Peritoneal Fibrosis. Tissue Eng. Part A (2013). doi:10.1089/ten.TEA.2013.0130 24007428
Kodama, S., Okamoto, T. & Suzuki, M. Sinonasal schwannoma with new bone formation expressing bone morphogenic protein. Int. J. Otolaryngol. 2010, 154948 (2010). 21197441
Okamoto, T., Kodama, S., Nomi, N., Umemoto, S. & Suzuki, M. Expression of bone morphogenic protein in sinonasal inverted papilloma with new bone formation. Allergy Rhinol. (Providence). 2, 16-20 (2011). 22852110 |
Protein Accession # |
BAA31853 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001191856 |
Tested Species Reactivity |
Human |
Gene Symbol |
BMP7 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 92%; Rat: 93% |
Image 1 | Human kidney (Proteinase K)
| Sample Type: Human kidney (Proteinase K) Primary Antibody Dilution: 1:1000Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:5000Color/Signal Descriptions: Brown: BMP7 Blue: DAPI Gene Name: Bmp7Submitted by: Christina Theodorpoulos, Queensland Univ. of Technology |
|
Image 2 | Human Skin
| Human Skin |
|
Image 3 | Human A549 Whole Cell
| Host: Rabbit Target Name: BMP7 Sample Tissue: Human A549 Whole Cell Antibody Dilution: 1ug/ml |
|
Image 4 |
| Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
|
|