Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP32328_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32328_P050-FITC Conjugated

ARP32328_P050-HRP Conjugated

ARP32328_P050-Biotin Conjugated

Bmp7 Antibody - N-terminal region (ARP32328_P050)

Rating:
80% of 100
Catalog#: ARP32328_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Skin
IHC Information: Kidney
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-34766 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Rat
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 92%; Rat: 93%
Complete computational species homology dataAnti-Bmp7 (ARP32328_P050)
Peptide SequenceSynthetic peptide located within the following region: MVAFFKATEVHLRSIRSTGGKQRSQNRSKTPKNQEALRMASVAENSSSDQ
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-Bmp7 (ARP32328_P050) antibody is Catalog # AAP32328 (Previous Catalog # AAPP03315)
Datasheets/ManualsPrintable datasheet for anti-Bmp7 (ARP32328_P050) antibody
Publications

Kitamura, S. et al. The Selection of Peritoneal Mesothelial Cells Is Important for Cell Therapy to Prevent Peritoneal Fibrosis. Tissue Eng. Part A. 20, 529-39 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 24007428

Kodama, S., Okamoto, T. & Suzuki, M. Sinonasal schwannoma with new bone formation expressing bone morphogenic protein. Int. J. Otolaryngol. 2010, 154948 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 21197441

Okamoto, T., Kodama, S., Nomi, N., Umemoto, S. & Suzuki, M. Expression of bone morphogenic protein in sinonasal inverted papilloma with new bone formation. Allergy Rhinol. (Providence). 2, 16-20 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 22852110

Gene SymbolBMP7
Official Gene Full NameBone morphogenetic protein 7
Alias SymbolsBMP-7, Bmp7
NCBI Gene Id655
Description of TargetThe function of Bmp7 remains unknown.
Swissprot IdP18075
Protein Accession #BAA31853
Nucleotide Accession #NM_001191856
Protein Size (# AA)431
Molecular Weight49kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express BMP7.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express BMP7.
Write Your Own Review
You're reviewing:Bmp7 Antibody - N-terminal region (ARP32328_P050)
Your Rating
Aviva Travel Grant
Aviva HIS tag Deal
Aviva Validation Data
Aviva Live Chat