Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP32328_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32328_P050-FITC Conjugated

ARP32328_P050-HRP Conjugated

ARP32328_P050-Biotin Conjugated

Bmp7 Antibody - N-terminal region (ARP32328_P050)

Rating:
80% of 100
Catalog#: ARP32328_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Skin
IHC Information: Kidney
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-34766 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide corresponding to a region of Rat
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 92%; Rat: 93%
Complete computational species homology data Anti-Bmp7 (ARP32328_P050)
Peptide Sequence Synthetic peptide located within the following region: MVAFFKATEVHLRSIRSTGGKQRSQNRSKTPKNQEALRMASVAENSSSDQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Bmp7 (ARP32328_P050) antibody is Catalog # AAP32328 (Previous Catalog # AAPP03315)
Datasheets/Manuals Printable datasheet for anti-Bmp7 (ARP32328_P050) antibody
Publications

Kitamura, S. et al. The Selection of Peritoneal Mesothelial Cells Is Important for Cell Therapy to Prevent Peritoneal Fibrosis. Tissue Eng. Part A. 20, 529-39 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 24007428

Kodama, S., Okamoto, T. & Suzuki, M. Sinonasal schwannoma with new bone formation expressing bone morphogenic protein. Int. J. Otolaryngol. 2010, 154948 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 21197441

Okamoto, T., Kodama, S., Nomi, N., Umemoto, S. & Suzuki, M. Expression of bone morphogenic protein in sinonasal inverted papilloma with new bone formation. Allergy Rhinol. (Providence). 2, 16-20 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 22852110

Gene Symbol BMP7
Official Gene Full Name Bone morphogenetic protein 7
Alias Symbols BMP-7, Bmp7
NCBI Gene Id 655
Description of Target The function of Bmp7 remains unknown.
Swissprot Id P18075
Protein Accession # BAA31853
Nucleotide Accession # NM_001191856
Protein Size (# AA) 431
Molecular Weight 49kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BMP7.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BMP7.
  1. What is the species homology for "Bmp7 Antibody - N-terminal region (ARP32328_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "Bmp7 Antibody - N-terminal region (ARP32328_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Bmp7 Antibody - N-terminal region (ARP32328_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Bmp7 Antibody - N-terminal region (ARP32328_P050)"?

    This target may also be called "BMP-7, Bmp7" in publications.

  5. What is the shipping cost for "Bmp7 Antibody - N-terminal region (ARP32328_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Bmp7 Antibody - N-terminal region (ARP32328_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Bmp7 Antibody - N-terminal region (ARP32328_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "49kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Bmp7 Antibody - N-terminal region (ARP32328_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "BMP7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BMP7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BMP7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BMP7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BMP7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BMP7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Bmp7 Antibody - N-terminal region (ARP32328_P050)
Your Rating
We found other products you might like!