ASCL2 Antibody - middle region (ARP32025_P050)

• Product Number: ARP32025_P050
• Name: ASCL2 Antibody - middle region (ARP32025_P050)
• Protein Size (# AA): 193 amino acids
• Molecular Weight: 20 kDa
• NCBI Gene Id: 430
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Achaete-scute complex homolog 2 (Drosophila)
• Alias Symbols: ASH2, HASH2, MASH2, bHLHa45
• Peptide Sequence: Synthetic peptide located within the following region: QALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Shahib,M.N., (2006) J Reprod Med 51 (11), 892-896
• Description of Target: AS-C proteins are involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system.This gene is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. Involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1649 BC028140.1 1-1649 1650-1864 BC057801.1 1286-1500
• Protein Interactions: EP300; APEX1; CALM3; CALM1; HCFC1; TUBB; KMT2C; NCOA6; TUBA4A; RBBP5;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ASCL2 (ARP32025_P050) antibody is Catalog # AAP32025 (Previous Catalog # AAPP02926)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ASCL2
• Uniprot ID: Q99929
• Protein Name: Achaete-scute homolog 2
• Publications:

  Park, J.-I. et al. B-cell translocation gene 2: expression in the rat ovary and potential association with adenine nucleotide translocase 2 in mitochondria. Mol. Cell. Endocrinol. 367, 31-40 (2013). 23273993

• Protein Accession #: NP_005161
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005170
• Tested Species Reactivity: Human
• Gene Symbol: ASCL2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rabbit: 77%; Rat: 100%; Zebrafish: 77%
• Image 1: Human DU145
  
  WB Suggested Anti-ASCL2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: DU145 cell lysate
• Image 2:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.