Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP32025_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32025_P050-FITC Conjugated

ARP32025_P050-HRP Conjugated

ARP32025_P050-Biotin Conjugated

ASCL2 Antibody - middle region (ARP32025_P050)

Catalog#: ARP32025_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-141297 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ASCL2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rabbit: 77%; Rat: 100%; Zebrafish: 77%
Complete computational species homology data Anti-ASCL2 (ARP32025_P050)
Peptide Sequence Synthetic peptide located within the following region: QALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ASCL2 (ARP32025_P050) antibody is Catalog # AAP32025 (Previous Catalog # AAPP02926)
Datasheets/Manuals Printable datasheet for anti-ASCL2 (ARP32025_P050) antibody
Target Reference Shahib,M.N., (2006) J Reprod Med 51 (11), 892-896
Publications

Park, J.-I. et al. B-cell translocation gene 2: expression in the rat ovary and potential association with adenine nucleotide translocase 2 in mitochondria. Mol. Cell. Endocrinol. 367, 31-40 (2013). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish 23273993

Gene Symbol ASCL2
Official Gene Full Name Achaete-scute complex homolog 2 (Drosophila)
Alias Symbols ASH2, HASH2, MASH2, bHLHa45
NCBI Gene Id 430
Protein Name Achaete-scute homolog 2
Description of Target AS-C proteins are involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system.This gene is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. Involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1649 BC028140.1 1-1649 1650-1864 BC057801.1 1286-1500
Swissprot Id Q99929
Protein Accession # NP_005161
Nucleotide Accession # NM_005170
Protein Size (# AA) 193
Molecular Weight 20kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ASCL2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ASCL2.
Protein Interactions EP300; APEX1; CALM3; CALM1; HCFC1; TUBB; KMT2C; NCOA6; TUBA4A; RBBP5;
Write Your Own Review
You're reviewing:ASCL2 Antibody - middle region (ARP32025_P050)
Your Rating