Search Antibody, Protein, and ELISA Kit Solutions

ASCL2 Antibody - middle region (ARP32025_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32025_P050-FITC Conjugated

ARP32025_P050-HRP Conjugated

ARP32025_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Achaete-scute complex homolog 2 (Drosophila)
NCBI Gene Id:
Protein Name:
Achaete-scute homolog 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-141297 from Santa Cruz Biotechnology.
Description of Target:
AS-C proteins are involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system.This gene is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. Involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1649 BC028140.1 1-1649 1650-1864 BC057801.1 1286-1500
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ASCL2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ASCL2.
The immunogen is a synthetic peptide directed towards the middle region of human ASCL2
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rabbit: 77%; Rat: 100%; Zebrafish: 77%
Complete computational species homology data:
Anti-ASCL2 (ARP32025_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ASCL2 (ARP32025_P050) antibody is Catalog # AAP32025 (Previous Catalog # AAPP02926)
Printable datasheet for anti-ASCL2 (ARP32025_P050) antibody
Target Reference:
Shahib,M.N., (2006) J Reprod Med 51 (11), 892-896

Park, J.-I. et al. B-cell translocation gene 2: expression in the rat ovary and potential association with adenine nucleotide translocase 2 in mitochondria. Mol. Cell. Endocrinol. 367, 31-40 (2013). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish 23273993

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...